KEGG   Vibrio campbellii: VIBHAR_06142Help
Entry
VIBHAR_06142      CDS       T00589                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vha  Vibrio campbellii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VIBHAR_06142
Enzymes [BR:vha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VIBHAR_06142
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1320238..1321155)
Genome map
AA seq 305 aa AA seqDB search
MNKLVVLGSVNADHVLQVPSFPRPGETLHGRNYQVIPGGKGANQAVAAARLNADIGFIAC
VGDDSFGINIRENFKMDGIDITGVKMQPNCPTGIAMIQVADSGENSICISAEANAKLTAE
AIEPDLERIRQADYLLMQLETPMCGIEKAARIAKDAKTNVILNPAPARELSDELLSCIDV
ITPNETEAEVLTGVTVTDDDSAQEAANILHSKGIEIVMITLGAKGVWLSQNGRGEIIPGF
RVEATDTTAAGDTFNGALVTGLLEDLPLESAIKFAHAAAAISVTRFGAQTSIPTRKEVEE
FLEQQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaataagttagtggtgttaggtagtgtaaacgctgaccatgttcttcaagtgccttct
ttccctcgccctggcgagacgctgcatggtcgcaactatcaagttatcccaggtggcaag
ggtgccaaccaagctgtggcggcagctcgattaaacgcagacatcggttttattgcgtgt
gttggtgatgattcgttcggcatcaacattcgtgagaacttcaaaatggatggcatcgat
atcactggtgtaaagatgcagccaaactgcccaacaggcattgccatgattcaggtggcg
gacagtggtgagaacagtatttgtatctccgcagaagcgaacgcaaaacttaccgcagaa
gcgattgagcccgacctagagcgcattcgtcaggcagattacttattgatgcaactagaa
acgccaatgtgcggtatcgagaaagcagcgcgaatcgcgaaagatgccaaaaccaacgtg
attctaaacccagcaccagctcgcgaactgtcagatgaattactgtcttgtattgatgtc
atcacaccaaatgaaacggaagcggaagtactcacaggcgtgacggtaacagacgatgat
agcgcacaagaagcggcaaacatcctgcattcgaaaggcattgaaatcgtcatgatcacg
ctcggtgcgaaaggggtgtggttgagtcaaaatggtcgtggtgaaatcattcctggcttc
cgcgtagaagcaacagataccactgcggctggcgatacgtttaatggggcattagtcact
ggtttattggaagacttacctttagaatcagcgattaagtttgcccacgctgcagctgcg
atctcagtaactcgctttggcgcgcaaacctccattccaacccgtaaagaggttgaggag
ttccttgaacaacaataa

DBGET integrated database retrieval system