KEGG   Vibrio campbellii: VIBHAR_06168Help
Entry
VIBHAR_06168      CDS       T00589                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vha  Vibrio campbellii
Brite
Enzymes [BR:vha01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VIBHAR_06168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1343572..1344543)
Genome map
AA seq 323 aa AA seqDB search
MKRKLTTKVLHGCLLMSFSASTLAGIQNTKINTSLVPTLEGDPKVDFQLARVGWHLFRDP
KLSSNGKISCETCHNLSTNGAEQTQVSTGVHGVGNRNSISVFNAALNYRFLWDGTANSLM
VQIDGPVQNPLEMDSNWEEIEKYIQANSLYKFLFEQTDKRINVTNIKRAIVEFVKGLQTP
SSPFDAYLRGDTDAMNEQSIGGWKAFQQVGCVQCHQGRNIGGSMIQQFSYFQTREKNLDT
GRHLRTSDGEDKFYFRVASLRNVGQTGPYFHNGQVDKLSDSIQIMSQVQLGVTMSDDKVA
DIEAFLMTLSSPRPAILEVFENE
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagagaaagcttactactaaagtgttacatggatgtttattaatgagttttagcgct
tcaactttagcaggaatacaaaatacaaaaatcaataccagcttagttcccactctcgaa
ggcgatcccaaggttgactttcaactggctcgtgttggttggcatttattcagggaccca
aaactgtcatcgaatggcaagatcagttgtgaaacctgccataacctatccactaatggt
gcagaacagacgcaagtttctactggagtacatggcgttggcaatcgtaattcaatctcc
gtttttaacgcggctttaaattatcggttcctgtgggatggcacagcaaattcgttgatg
gttcaaatcgacggacctgtccaaaaccctttagaaatggattctaattgggaagagata
gaaaagtatattcaagctaattcgttatataaatttctatttgagcaaacggataaacgc
attaatgtgaccaacattaagcgtgcaattgtggagtttgttaaagggctccagacgcca
agctctccatttgatgcgtatttacgtggtgatacggacgctatgaatgaacagtcaata
ggagggtggaaggcctttcagcaagtgggctgtgttcagtgccaccaggggcggaatatt
ggcgggtccatgattcagcagtttagttattttcaaacgcgagaaaaaaatcttgatacg
gggcgacatttaagaacctctgatggagaggataaattctattttcgtgtggcaagcttg
cgaaatgtggggcaaaccgggccttattttcacaatgggcaagttgataaactatcggat
tctattcaaattatgtcgcaggtccagttgggggtaacgatgagcgacgacaaagtggca
gatatcgaagccttcctgatgacgttaagttccccaaggcctgcaattttggaggtgttt
gaaaatgaataa

DBGET integrated database retrieval system