KEGG   Vibrio campbellii: VIBHAR_06375Help
Entry
VIBHAR_06375      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
vha  Vibrio campbellii
Brite
Enzymes [BR:vha01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     VIBHAR_06375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Haem_bd Cytochrom_C Cytochrome_CBB3 DHOR DUF1924
Motif
Other DBs
NCBI-ProteinID: ABU74266
UniProt: A7N8M8
Position
II:complement(1546971..1548284)
Genome map
AA seq 437 aa AA seqDB search
MAQQNLTQFSSLDQSTLDYQAMKVLADKGCGYCHTPSSEMLFYSEIPVAKQIMEADLKVA
IRHFDMTNLLDDVKQNDPVSEVALARLEKVLYDDSMPPAIYLTMHWSASMSKDEKHTLLK
WIREKRAERHAQSPVSEERKTKVLQPIYTTFETEADKAELGRVLYHDTRLSGDNTVSCAS
CHSLDTGGVDRLVTSVGIHGQVGGINAPTVFNAVYNKLQFWDGRAADLQDQAGGPPFNPI
EMGSMDWDEIVDKLSQDPDMVAMFQKVYSGEINGNNITDAIAEFEKTLTTPNSRFDQYMM
GDTKALDSHEKYGLMLFKKYDCQTCHAGEAMGGETFETMGMKAGYFADRGTDMTDADLGR
YNFTGNKEDKHKFKVPTLRNIELTAPYFHDGHADTLEKAIYDMGKYQVGVEMSDEEVDAI
KAFLKTLTGDYEGRPLS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaacaaaatctgacgcaatttagttcgttagatcaatcgacactggattatcaa
gcgatgaaggtattggcggataaaggttgtggctactgtcatacgccgagcagtgaaatg
cttttctattctgaaataccagtggcaaaacaaattatggaagcggatttgaaagtggcc
atacgtcactttgacatgacaaacttgctggatgacgtgaagcagaacgatccagtttct
gaagtggctttggctcgtcttgagaaggtgctctacgacgattctatgccgccagcgatt
tacctgaccatgcactggtctgcaagtatgtcgaaagatgaaaaacacacgctattgaaa
tggattcgtgaaaagcgtgctgagcgccacgcacaatcaccggtatctgaagaacgtaaa
accaaagttctacaaccaatttacactacgtttgaaaccgaagcagacaaggctgaactg
ggtagggtgctttaccacgacacacgactttcaggcgacaatacggtctcatgtgcatca
tgccacagccttgatacaggcggcgtggaccgactcgtaacgtctgttggtattcatggc
caagtgggtggcatcaacgcgccaaccgtttttaatgctgtgtacaacaagctgcaattc
tgggatggtcgtgccgcggatctgcaagaccaagcgggtggtcctccgtttaacccgatt
gaaatgggctctatggattgggatgaaatcgtcgataagttaagccaagacccagacatg
gtggcgatgtttcaaaaggtttactcaggtgagattaatggcaacaacattacggatgcg
attgccgaatttgagaaaaccctaaccacaccaaacagccgcttcgaccaatacatgatg
ggtgatacaaaggcgctggactcccacgagaaatacggtttgatgctgttcaagaagtac
gactgtcaaacctgtcacgcgggtgaagcgatgggtggtgaaacgtttgaaaccatgggt
atgaaagcgggttactttgcggaccgtggtactgacatgacggatgcagaccttggtcgt
tacaacttcactggcaacaaagaagacaaacataagttcaaagtgccaaccttgcgcaac
attgaactgaccgcaccatacttccacgatggccatgctgatacgctagaaaaagccatc
tacgacatgggtaaataccaagtcggagtggaaatgtcggatgaagaagtggatgccatc
aaagcgttcttgaaaacactgacgggtgattatgaaggccgtcctttaagttaa

DBGET integrated database retrieval system