KEGG   Vibrio campbellii: VIBHAR_06577Help
Entry
VIBHAR_06577      CDS       T00589                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
vha  Vibrio campbellii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    VIBHAR_06577
Enzymes [BR:vha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     VIBHAR_06577
    3.5.1.-  
     VIBHAR_06577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1725136..1725828
Genome map
AA seq 230 aa AA seqDB search
MANASIETDKESAMTVLVNYQTTAVIDVDPEKGFTELCPDELPVTGALEIVPELLKNHTK
GRLKLVSRDLHPPKAAWDAETPANMLEPVGLPNVDIKWNRHCVLGTTGVELLDGLPPVLE
YDFQVNKGMDPDAHPYGIFFHDVADTKTTGTNEFLKFNHIDTVVVGGLALDFCVKKSVTQ
ALELGFKVIVNLASSRAVLPDTIDAVIAEMEEKGAVFVKNADDIIVENFA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtggctaacgcaagcatagagacagacaaggagtctgccatgaccgttctagttaattat
caaaccactgctgtgatcgatgtcgatccagagaaaggtttcaccgaactttgccctgac
gaactgccagttactggcgcattagaaatcgttccagagctgcttaagaaccacacgaaa
ggtcgtttgaaattagtcagccgtgacttgcacccaccaaaagcggcttgggatgcagaa
acgccagcaaatatgcttgagccagttggcctgcccaatgtggatattaagtggaaccgc
cactgtgtgcttggtactactggggtagaactactagacggtctaccacctgttctggaa
tacgatttccaagtgaacaaaggtatggatccagacgcccacccctacggcatctttttc
catgacgtggcggataccaaaaccaccggtacgaatgagttcttaaaattcaaccacatc
gacaccgtggttgttggtggcttggcactcgatttttgtgtgaaaaagtccgtcactcaa
gctctagagttaggtttcaaagtgattgtgaacctagcatctagccgcgcggtattgcca
gatactatcgatgcggtcattgctgaaatggaagagaaaggcgcggtgtttgttaaaaat
gcagatgacatcatcgtagaaaacttcgcttag

DBGET integrated database retrieval system