KEGG   Vibrio campbellii: VIBHAR_06694Help
Entry
VIBHAR_06694      CDS       T00589                                 

Definition
hypothetical protein
Orthology
K13590  
diguanylate cyclase
Organism
vha  Vibrio campbellii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1829940..1830953
Genome map
AA seq 337 aa AA seqDB search
MTDEFKKSTANLKKAVPLMIKNHVAATPANYALWYTYVDKTIPELNQELDMVLENYDVCP
PAMHKQLYNSYVASKAETSLEELKTNVEVLLGEVSSSMSDTITDTSSFSDMVDKSFNKLE
KVEDNSLSIEEVMNVVRQLVAESREIRHSTQFLNSQLTTASEEISRLKNQLAEVQKDALF
DGLSNLYNRRAFDSDLQMLIDSNQAMTLVMLDIDHFKAFNDNYGHLFGDTVIKAIARRLQ
QSCRDGISAYRFGGEEFALIIPNKSLRIGRQYADTLRRMIEKLRVRDKRSGSQVQSITAS
FGVAEYEVGDTLESLVNKADKQLYEAKQLGRNRVMPL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgaatttaaaaaatcaaccgcgaatctaaaaaaagcggtaccactaatgatc
aagaaccacgtagcagcgacaccagcaaactacgccttgtggtacacctacgtagacaaa
accatcccagagcttaaccaagagttagatatggttctggagaattatgacgtctgccca
ccagcgatgcacaagcagctctacaacagctacgtcgcgagtaaagccgaaaccagttta
gaagaactcaaaaccaacgtagaagtgctgttgggtgaagtatctagctcgatgagtgac
actattacggatacctcctccttctctgatatggtggacaaaagctttaacaagcttgaa
aaggttgaagataatagcctgagtattgaagaagtgatgaatgtggttcgtcagctcgtc
gcggaatctcgtgaaattcgtcactcgactcagtttctaaatagccaactaacaacggct
agtgaagaaatttctcgtctaaaaaaccaattggccgaagtacaaaaagacgctcttttc
gatggtctttccaatctgtataaccgccgtgctttcgacagtgacctccaaatgctgatc
gacagcaatcaagcaatgaccttggttatgctggatattgatcacttcaaagcatttaac
gacaattacggccacttgtttggcgataccgttatcaaagccatcgcacgtcgtctgcaa
caaagctgtcgtgatggcatcagcgcttaccgctttggtggcgaagagtttgctttgatc
ataccgaataaatcgttgcgcatcggtcgtcaatacgccgatacgttacgccgaatgatc
gaaaagctgcgtgtccgtgacaaacgttcgggcagccaagtgcaaagtattaccgcttct
tttggtgtcgcagagtatgaagttggcgatacgttggaaagcttggttaataaggctgat
aaacagttgtatgaagcaaaacaactgggccgaaaccgagtaatgccgctgtag

DBGET integrated database retrieval system