KEGG   Vibrio campbellii: VIBHAR_06694Help
Entry
VIBHAR_06694      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
vha  Vibrio campbellii
Brite
Enzymes [BR:vha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     VIBHAR_06694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:1829940..1830953
Genome map
AA seq 337 aa AA seqDB search
MTDEFKKSTANLKKAVPLMIKNHVAATPANYALWYTYVDKTIPELNQELDMVLENYDVCP
PAMHKQLYNSYVASKAETSLEELKTNVEVLLGEVSSSMSDTITDTSSFSDMVDKSFNKLE
KVEDNSLSIEEVMNVVRQLVAESREIRHSTQFLNSQLTTASEEISRLKNQLAEVQKDALF
DGLSNLYNRRAFDSDLQMLIDSNQAMTLVMLDIDHFKAFNDNYGHLFGDTVIKAIARRLQ
QSCRDGISAYRFGGEEFALIIPNKSLRIGRQYADTLRRMIEKLRVRDKRSGSQVQSITAS
FGVAEYEVGDTLESLVNKADKQLYEAKQLGRNRVMPL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgaatttaaaaaatcaaccgcgaatctaaaaaaagcggtaccactaatgatc
aagaaccacgtagcagcgacaccagcaaactacgccttgtggtacacctacgtagacaaa
accatcccagagcttaaccaagagttagatatggttctggagaattatgacgtctgccca
ccagcgatgcacaagcagctctacaacagctacgtcgcgagtaaagccgaaaccagttta
gaagaactcaaaaccaacgtagaagtgctgttgggtgaagtatctagctcgatgagtgac
actattacggatacctcctccttctctgatatggtggacaaaagctttaacaagcttgaa
aaggttgaagataatagcctgagtattgaagaagtgatgaatgtggttcgtcagctcgtc
gcggaatctcgtgaaattcgtcactcgactcagtttctaaatagccaactaacaacggct
agtgaagaaatttctcgtctaaaaaaccaattggccgaagtacaaaaagacgctcttttc
gatggtctttccaatctgtataaccgccgtgctttcgacagtgacctccaaatgctgatc
gacagcaatcaagcaatgaccttggttatgctggatattgatcacttcaaagcatttaac
gacaattacggccacttgtttggcgataccgttatcaaagccatcgcacgtcgtctgcaa
caaagctgtcgtgatggcatcagcgcttaccgctttggtggcgaagagtttgctttgatc
ataccgaataaatcgttgcgcatcggtcgtcaatacgccgatacgttacgccgaatgatc
gaaaagctgcgtgtccgtgacaaacgttcgggcagccaagtgcaaagtattaccgcttct
tttggtgtcgcagagtatgaagttggcgatacgttggaaagcttggttaataaggctgat
aaacagttgtatgaagcaaaacaactgggccgaaaccgagtaatgccgctgtag

DBGET integrated database retrieval system