KEGG   Vibrio campbellii: VIBHAR_06695Help
Entry
VIBHAR_06695      CDS       T00589                                 

Definition
(GenBank) hypothetical protein
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
vha  Vibrio campbellii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VIBHAR_06695
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VIBHAR_06695
   00630 Glyoxylate and dicarboxylate metabolism
    VIBHAR_06695
Enzymes [BR:vha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VIBHAR_06695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
Position
II:complement(1831064..1831642)
Genome map
AA seq 192 aa AA seqDB search
MNMLNFDKKDIQQQERPFIAEAVFAVEAVSAEQQSEKQVKAKQLLDRMFPLENGSHQDVS
SYVIDYRHVMAYFKDGTHSGLKSPKHFVAYTGEKEDPKSILFKDESGSHVEVMFGCHKGT
GCVELMDIDDIQLETRTTFSPELIGNAPTAMRHWISLIKGDKKGKPMACSEDKEYTAKNG
DDYFLSYCYSID
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgaatttcgataaaaaagacatccaacaacaagaacgcccatttatcgct
gaagccgtatttgccgtcgaggcggttagtgctgagcagcaaagcgagaagcaagttaag
gcgaagcaactactggaccgtatgttcccactggagaatggttcacaccaagacgtatca
agctatgtgattgattaccgccatgtgatggcctacttcaaagacggtacacacagcggt
ctgaaaagcccaaaacattttgtagcgtacactggtgagaaagaagatccgaaatcgatt
ctatttaaagatgagtcaggcagccacgtagaagtgatgtttggctgtcataaaggcacg
ggttgtgtggagttgatggacattgatgacattcaactggaaacacgtactaccttcagc
cctgagctaattggtaatgcaccgaccgcaatgcgtcattggatcagcctaattaaaggt
gataagaaaggaaaaccgatggcgtgcagtgaagacaaagagtacaccgcgaaaaacggc
gacgactacttccttagctactgctacagcattgattaa

DBGET integrated database retrieval system