KEGG   Vibrio campbellii: VIBHAR_06695Help
Entry
VIBHAR_06695      CDS       T00589                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vha  Vibrio campbellii
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VIBHAR_06695
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VIBHAR_06695
   00630 Glyoxylate and dicarboxylate metabolism
    VIBHAR_06695
Enzymes [BR:vha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VIBHAR_06695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1831064..1831642)
Genome map
AA seq 192 aa AA seqDB search
MNMLNFDKKDIQQQERPFIAEAVFAVEAVSAEQQSEKQVKAKQLLDRMFPLENGSHQDVS
SYVIDYRHVMAYFKDGTHSGLKSPKHFVAYTGEKEDPKSILFKDESGSHVEVMFGCHKGT
GCVELMDIDDIQLETRTTFSPELIGNAPTAMRHWISLIKGDKKGKPMACSEDKEYTAKNG
DDYFLSYCYSID
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgctgaatttcgataaaaaagacatccaacaacaagaacgcccatttatcgct
gaagccgtatttgccgtcgaggcggttagtgctgagcagcaaagcgagaagcaagttaag
gcgaagcaactactggaccgtatgttcccactggagaatggttcacaccaagacgtatca
agctatgtgattgattaccgccatgtgatggcctacttcaaagacggtacacacagcggt
ctgaaaagcccaaaacattttgtagcgtacactggtgagaaagaagatccgaaatcgatt
ctatttaaagatgagtcaggcagccacgtagaagtgatgtttggctgtcataaaggcacg
ggttgtgtggagttgatggacattgatgacattcaactggaaacacgtactaccttcagc
cctgagctaattggtaatgcaccgaccgcaatgcgtcattggatcagcctaattaaaggt
gataagaaaggaaaaccgatggcgtgcagtgaagacaaagagtacaccgcgaaaaacggc
gacgactacttccttagctactgctacagcattgattaa

DBGET integrated database retrieval system