KEGG   Vibrio campbellii: VIBHAR_06724Help
Entry
VIBHAR_06724      CDS       T00589                                 

Definition
phospho-beta-glucosidase B
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
vha  Vibrio campbellii
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VIBHAR_06724
Enzymes [BR:vha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     VIBHAR_06724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1858165..1859556
Genome map
AA seq 463 aa AA seqDB search
MITFPEHFLWGGAIAANQVEGSYNLGGKGLSTSDMLPNGILSPHQTREERTPGIKDVAID
FYNRYPEDIALFKEMGFNCLRLSLAWSRIFPNSDELEPNEEGLAFYDKIFDELAKHDIQP
FVTLSHYEMPYALVENFGGWGDRRVIEFFERYAHTVLERYKDKVKLWLTFNEINMSLHAP
FTGVGLQEDASEQEIYQAIHHQLVANAKAVKLCQQIVPNGKIGNMLLGAINYPYTCNPDD
VLAAMHENNKWLFFGDVQTRGQYPGYMKRYFRENGIEIEMEEGDLEEIAAASVDFISFSY
YASGCASADPKQKEVGNIVDSVPNPYLEKSQWGWLIDPKGLRVLLNFLHDRYQKPLFVVE
NGLGARDEIDENGEIQDDYRIAYLNDHLVQAHEAILDGVELMGFTSWGPIDLVANSTAEM
SKRYGYIYVDRHNDGQGTLERKRKKSFFWYQDVIRTAGGSLKS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgattacgtttcctgaacattttctttggggcggcgctattgctgcaaaccaagtagaa
gggtcgtacaaccttgggggtaaagggttatcgacgtcagacatgctgccaaacggtatt
ttgagtccgcatcaaacccgtgaagaacgaacgccgggtatcaaagacgtggcgatcgac
ttctacaatcgctacccagaagacattgcgctattcaaagagatgggctttaactgcctg
cgtctgtctttggcatggagccgcatcttcccgaacagcgacgaacttgaacctaacgaa
gaaggtttggcgttctacgataaaatttttgatgaactggcgaagcacgatatccaacct
ttcgtaaccttatctcactacgaaatgccttacgcactggtcgagaacttcggtggttgg
ggcgatcgtcgcgtgatcgaattcttcgagcgttatgctcacaccgtgcttgaacgctac
aaagacaaagtgaagctgtggttaacgttcaacgaaatcaatatgtctctgcatgcgcca
tttaccggtgttggtttgcaagaagacgctagcgaacaagagatttatcaagcaattcac
caccagttagtggcaaatgcgaaagcggtaaaactgtgccagcaaatcgtaccgaacggc
aagattggtaacatgctgcttggcgcgatcaactacccatacacctgtaaccctgatgac
gtgctggcagcaatgcacgaaaacaacaaatggttgttcttcggtgatgtacaaactcgt
ggtcagtacccaggctacatgaagcgttacttccgcgaaaatggcattgaaatcgagatg
gaagaaggcgacttagaagagatcgcagcagcaagtgtcgacttcatctcattcagctac
tacgcaagtggctgtgcaagtgcggaccctaaacagaaagaagtgggtaacatcgtcgat
agcgtaccaaacccataccttgaaaagagccaatggggttggttgatcgatccaaaaggc
ctgcgagttttgttgaatttccttcacgatcgctaccaaaagccactgttcgtcgtagaa
aacggcttaggtgcgcgtgatgaaatcgatgaaaacggtgagattcaagatgattaccgc
atcgcttacttgaacgatcaccttgtgcaagcgcacgaagcgattcttgatggtgttgag
ttgatgggcttcactagctggggaccaatcgatttagtcgcaaactcaaccgctgaaatg
agcaagcgttacggttacatctacgttgatcgccacaacgatggccaaggtacgttagaa
cgtaaacgtaagaagagcttcttctggtatcaagatgtcattcgcactgcaggcggttct
ctcaaaagctag

DBGET integrated database retrieval system