KEGG   Vibrio campbellii: VIBHAR_06738Help
Entry
VIBHAR_06738      CDS       T00589                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vha  Vibrio campbellii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vha00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VIBHAR_06738
Enzymes [BR:vha01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     VIBHAR_06738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1870458..1871378
Genome map
AA seq 306 aa AA seqDB search
MNDLFTKTDYSLYSNSMSFLRRPYVKNPVSADADVVVLGVPLDMATSGRPGARMGPDAIR
RASVNLAWEGKKFPWDFNVFDKLKVIDAGDLVFDCGDAEDFTYRLEAATSEILKSGKTML
GLGGDHFITLPILRAYAKHHGQMALIHFDAHTDTYANGSSYDHGTMFYHAPKEGLISAKN
SVQIGIRTEYDQQDHGFNVINAMQANDMSVEEILAEIRRTVADKPVYVTFDIDCLDPAFA
PGTGTPVCGGLNSDKILKIIRGFAGMNIVGMDVVEVSPPYDHSDVTALAGATIALELLYA
YASGRE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttgtttactaaaaccgattattcgctttactccaactctatgtcgtttcta
cgtcgaccgtacgtcaaaaacccagtatcggcagacgcagacgttgtggtgctcggggtt
cctctggacatggcgacttctggtcgtcctggtgcgcgtatgggtccagatgcgatccgc
cgtgcgtcagtaaaccttgcttgggaaggcaagaagttcccttgggacttcaacgtattt
gataaattgaaagtgatcgacgcaggtgaccttgtgttcgattgtggtgatgctgaagat
ttcacttaccgcctagaagcggcaacaagtgagattctaaagagcggtaagacaatgcta
ggcttgggtggtgaccactttatcacgctaccaatcctacgtgcttacgcgaagcaccat
ggtcaaatggcactgattcacttcgatgcgcacacagacacttacgcaaatggcagttct
tacgaccacggtactatgttctaccatgcgccaaaagaaggcctgatctctgcgaagaac
tcagttcaaattggtattcgtactgaatatgaccaacaagatcacggcttcaatgtgatc
aacgcgatgcaagcgaacgacatgtcggtagaagagattctggcagaaatccgtcgcacg
gttgcggataagcctgtgtatgtcacgtttgacatcgactgtctggatcctgcgtttgca
ccgggtacaggtacaccagtttgtggtggcctgaactcagataaaattctgaagatcatt
cgtggtttcgcaggcatgaatatcgtaggtatggacgtggtggaagtctctcctccttac
gaccacagcgatgtgacggccttggctggcgcgactatcgcacttgagttgctttacgcc
tacgcttcaggtcgcgaataa

DBGET integrated database retrieval system