KEGG   Verrucosispora maris: VAB18032_00565Help
Entry
VAB18032_00565    CDS       T01471                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
vma  Verrucosispora maris
Pathway
vma00020  Citrate cycle (TCA cycle)
vma00640  Propanoate metabolism
vma00660  C5-Branched dibasic acid metabolism
vma01100  Metabolic pathways
vma01110  Biosynthesis of secondary metabolites
vma01120  Microbial metabolism in diverse environments
vma01130  Biosynthesis of antibiotics
vma01200  Carbon metabolism
Module
vma_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vma_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VAB18032_00565 (sucC)
   00640 Propanoate metabolism
    VAB18032_00565 (sucC)
   00660 C5-Branched dibasic acid metabolism
    VAB18032_00565 (sucC)
Enzymes [BR:vma01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     VAB18032_00565 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AEB47197
UniProt: F4FB52
Position
complement(5803769..5804947)
Genome map
AA seq 392 aa AA seqDB search
MDLYEYQGRDLFERHGLPVLAGGVATTPEEARAIAERLGGRVVVKAQVKVGGRGKAGGVK
LAEGAEETVARATDILGMDIKGHTVHKVMITVTADVAEEYYFSYLLDRANRTFLCIASVA
GGMDIEQVAADTPEKVVKAPIDAVKGVDEAKAREIVEAAGFPAEVADQVVETAVGLWQAF
VAEDATLVEVNPLAKTKDGKLLLLDAKVSLDENAGFRHPDHEALVDQATVDPLEQAAKEK
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGERHGNVKPANFLDIGGGASAAVMANGLE
IVLSDPSVKSVFVNVFGGITACDAVANGIVQALDLLKQRGEEVTKPLVVRLDGNNAEAGR
AILDGANNPLIERVDTMDGAAERAAELAAAGV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtacgaataccaggggcgggacctgttcgagcggcacggcctgcccgtgctc
gccggcggcgtcgctacgaccccagaggaggcccgcgcgatcgccgaacgcctcggcggc
cgggtggtcgtcaaggcacaggtgaaggtcggcggccgaggcaaggccggtggcgtcaag
ctggccgagggcgcggaggagacggtggcccgcgccaccgacatcctcggcatggacatc
aagggtcacacggtccacaaggtcatgatcacggtgaccgccgacgtggccgaggagtac
tacttctcgtacctgctcgaccgggcgaaccgcaccttcctctgcatcgccagcgtggcc
ggcggcatggacatcgagcaggtcgccgccgacaccccggaaaaggtcgtcaaggccccc
atcgacgcggtcaagggcgtcgacgaggccaaggcgcgggagatcgtcgaggcggccggc
ttcccggccgaggtcgccgaccaggtcgtcgagaccgcggtgggcctgtggcaggcgttc
gtcgccgaggacgccaccctggtcgaggtgaacccgctggccaagaccaaggacggcaag
ctgctgctgctggacgccaaggtctcgctcgacgagaacgccggcttccggcacccggat
cacgaggccctggtcgaccaggccaccgtggacccgctggagcaggccgccaaggagaag
gacctcaactacgtcaagctcgacggcgaggtcggcatcatcggcaacggcgcgggtctg
gtcatgtcgaccctcgacgtggtcgcctacgcgggcgagcggcacggcaacgtcaagccg
gccaacttcctcgacatcggtggcggcgcgagcgccgcggtgatggcaaacggtctggag
atcgtgctctccgacccgtcggtgaagagtgtcttcgtcaacgtcttcggcggcatcacc
gcctgcgacgcggtcgccaacggcatcgtccaggcgctggacctgctcaagcagcgtggc
gaggaagtcaccaagccgctcgtcgtacgcctcgacggcaacaacgccgaggccggtcgg
gcgatcctcgacggcgcgaacaacccgctcatcgagcgggtcgacaccatggacggcgcg
gccgagcgggccgccgagctggcggctgcgggggtctga

DBGET integrated database retrieval system