KEGG   Verrucosispora maris: VAB18032_00675Help
Entry
VAB18032_00675    CDS       T01471                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
vma  Verrucosispora maris
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    VAB18032_00675
Enzymes [BR:vma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     VAB18032_00675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5830793..5832460)
Genome map
AA seq 555 aa AA seqDB search
MRYDVVVIGSGFGGSVAALRLAEKGYSVGVLEAGRRFADDEFPQTSWRLRRFLWAPKLGC
FGLQRITLLRAADRRAGGGVLVLSGSGVGGGSLVYANTLYEPLDAFYTDPQWRDITDWRA
ELAPHFAQAKRMLGVTTYPLHTPADRAMRRVADRMGVGHTFHATPVGVYIGRPGERVADP
YFGGAGPERTGCTNCGACMTGCRYGAKNTLVKNYLWLAERLGAQVHPLTTVTAVRPCGDG
YAVHTERTGAWLRKRPQVIHADQVVFAAGALGTQRLLHEMRERGALPNISSTLGRLTRTN
SEAILGASVPRRRARAAGVDYSEGVAITSSFHPDPQTHIEPVRYGRGSNAMGLLQSLLVD
GGPHRVRRWLGQLVRHPWQAARLLLVRNWSERTVIALVMQSADNSLTTRLRRGPLGRRLV
AAPGHGTGNPTWIPAGNRAARLLAEEIDGTPGGALTEPFDIPMTAHILGGAVIGATPETG
VIDPYHRVYGHPGLYVVDGAAISANLGVNPSLTITAQAERAMSLWPNKNTPDPRPPQTSP
YRPLPPIPPTHPALP
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgcggtacgacgtggtcgtcatcgggtcgggcttcggcggtagcgtggccgccctgcgg
ctggccgagaagggttactcggtcggcgtcctggaggcgggccgacggttcgccgacgac
gagttcccgcagacctcgtggcgactgcggcggttcctctgggcaccgaagctgggctgc
ttcggcctgcaacggatcaccctgctgcgggcggccgaccggcgggccggcggcggggtg
ctggtgctgtccggttcgggggtcggcggcggctcgctggtctacgccaacacgctgtac
gagccgcttgacgccttctacaccgacccccagtggcgggacatcaccgactggcgggct
gaactcgccccgcacttcgcccaggcgaagcggatgctcggggtgaccacgtacccgctg
cacacccccgcggaccgggcgatgcggcgggtggccgaccggatgggggtggggcacacc
ttccacgccaccccggtcggggtgtacatcgggcgaccgggtgagcgggtggccgacccg
tacttcggcggtgccgggccggagcgtaccggctgcaccaactgtggcgcctgcatgacc
ggatgccggtacggcgcgaagaacaccctggtcaagaactacctgtggctggccgagcgg
ctcggtgcccaggtgcatccgctgaccacggtcaccgccgtgcggccttgcggcgacggg
tacgccgtacacaccgaacgcaccggcgcctggctgcgcaagcgcccgcaggtgatccac
gccgaccaggtggtcttcgccgccggcgcgctcggcacccaacggctgctgcacgagatg
cgtgagcgtggtgccctgcccaacatctcgtcgacgctgggtcggctgacccggaccaac
tcggaggccatcctcggcgcctcggtgccgcgtcggcgggcccgggccgccggagtggac
tactccgagggggtggcgatcaccagttcgttccaccccgatccgcagacccacatcgag
ccggtccgctacgggcgcggctcgaacgcgatgggtctgctgcaatccctgcttgtcgac
ggcgggccgcaccgggtacgccgctggctcggtcaactcgtccggcatccctggcaggcc
gcccggctgctgctggtgcgcaactggtccgagcgtacggtgatcgccctggtgatgcag
tcggcggacaactcgctcaccacccggctgcggcgcgggccgctgggtcgtcgcctggtc
gccgcccccggccacggcaccggaaacccgacctggatccccgccggcaaccgggcggcc
cgactactcgccgaagagatcgacggtacgcccggcggcgcgctgaccgaaccgttcgac
atcccgatgaccgcccacatcctcggcggcgcggtgatcggcgccacccccgagaccggt
gtcatcgacccgtaccaccgcgtctacggccaccccggcctgtacgtcgtcgacggcgcc
gccatctcggccaacctgggcgtcaacccctccctcaccatcaccgcccaggccgaacgc
gccatgtccctctggcccaacaagaacacccccgacccccgccccccacaaacctccccc
taccgccccctccctcccatccccccaacccaccccgccctcccctga

DBGET integrated database retrieval system