KEGG   Verrucosispora maris: VAB18032_00775Help
Entry
VAB18032_00775    CDS       T01471                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
vma  Verrucosispora maris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5853245..5854354)
Genome map
AA seq 369 aa AA seqDB search
MLAAAAFAAVLATTGTIAISAGTAHAEADRQVCSNTEGTHNGFFFSFWKDSGDACMVLRE
NGRYSSSWSRSTNNWVGGKGWNPGTRRTITYSGSYNPGNNNSYLALYGWTRNPLVEYYIV
ENFGSYNPSSGATRLGSITTDGGTYDILRSQRVNQPSIDGTATFYQYWSVRQQKRSSGTI
TTANHFDAWARVGLNLGNHYYQIMATEGYQSQGSSDITVSEGGTPGPGPTNPTNPTTPPP
SGGSGQMIVGQQSGRCLDVPNSSTSNGTQIQLYDCWGGSNQRFTHTSSRQLTVNGKCLDA
ANQGTSNGTRVTIYDCHGGANQQWNINSNGTITGVQSGLCLDAGGSGNGALLQLYSCWGG
ANQQWSRRN
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgctggctgccgccgccttcgccgcagtgctggccaccaccggcaccatcgcgatctcg
gccggcaccgcccacgccgaggccgaccggcaggtctgctcaaacacggaaggcacccac
aacgggttcttcttctcgttctggaaggacagcggcgacgcctgcatggtgttgcgcgag
aacggccgctactccagctcgtggagcaggagcaccaacaactgggtcggtggcaagggc
tggaaccccggaacccgccgcacgatcacctactcgggcagctacaacccgggcaacaac
aacagctatctcgccctgtacggctggacccgtaacccgcttgtcgagtactacatcgtc
gagaacttcggcagctacaacccgagcagcggcgccacccggctcggcagcatcaccacc
gacggcggcacctacgacatcctgcgcagccagcgggtcaaccagccctcgatcgacggc
accgcgacgttctaccagtactggagcgtccggcagcagaagcgcagtagcggcaccatc
accaccgccaaccacttcgacgcctgggcccgcgttggcctgaacctgggcaaccactac
taccagatcatggccaccgagggttaccagagccagggaagctcggacatcaccgtctcg
gaaggcggcacccccggccccggcccgaccaacccgaccaacccgaccaccccgccgccc
agtggcggtagcggccagatgatcgtcggtcagcagtccggccggtgcctggacgtgccg
aactcgagcaccagcaacggcacccagatccagttgtatgactgctggggtggctcgaac
cagcggttcacccacacctcgagccggcagctgacggtgaacggcaagtgcctggatgcc
gcgaatcagggcaccagcaacggtacgcgggtgaccatctacgactgccacggcggcgcg
aaccagcagtggaacatcaactccaacggcacgatcaccggagtgcagtcagggttgtgc
ctcgacgccggtggcagcggtaacggggcgcttctccagctgtacagctgctggggtgga
gccaaccagcagtggagccgccgcaactga

DBGET integrated database retrieval system