KEGG   Verrucosispora maris: VAB18032_00875Help
Entry
VAB18032_00875    CDS       T01471                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
vma  Verrucosispora maris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VAB18032_00875
Enzymes [BR:vma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     VAB18032_00875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5876970..5878058
Genome map
AA seq 362 aa AA seqDB search
MREELAGFTIGVTADRRRDELAALLQRRGARVVLAPALRIVPLADDSALREATRACLDRP
PDVLMANTGIGMRGWLEAAEGWGVAEPLRSVLSDAYVVARGPKARGAIRAAGLYDQWSPE
SESCDEVVEHLRQRGVAGQVIAMQLHGDRQPECTRALEEAGATVIEIPVYRWAPPTDPAP
LHRLVDLVAGRLVDAVTFTSAPAAEALLRAAGDRTEAVLAALRSDVLASCVGPVTAEPLV
RRGVPVSAPSRARLGALVRTIVDELPRRTVTIKVAGHLLTLRGHAAVIDGELRPLAPAPM
AVLRALAQSPGRVLSRTALLRTLPRGADEHAVEMAVARLRAGLKAPRVVQTVVKRGYRLR
VD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaggaactggccggcttcaccatcggggtgaccgccgaccggcggcgagacgaa
ctcgccgcgctgctccagcggcgcggcgcgcgggtggtgctcgcgcccgcgctgcggatc
gtgccgctcgcggacgacagcgcgctgcgcgaggccacccgggcctgcctggaccggcca
ccggacgtgctgatggccaacaccggaatcggcatgcgcgggtggctggaggccgccgaa
ggctggggggtcgccgagccgctgcgctcggtgctcagcgacgcgtacgtggtggcccgg
ggcccgaaggcacgtggcgcgatccgcgcggccggcctgtacgaccagtggtctccggaa
tcggagagctgtgacgaggtcgtcgagcacctgcgccagcggggggtggccgggcaggtg
atcgccatgcagttgcacggcgatcggcagcccgagtgcacccgtgccctggaggaggcc
ggggcgaccgtcatcgagatcccggtctaccgctgggcgccacctaccgatccggcgccc
ctgcaccggctggtcgacctggtggccggccggctggtggacgcggtcaccttcacctcg
gcgccggcggcggaggcgctgctccgcgctgcgggcgaccggacggaggcggtcctggcc
gcgttgcgcagcgacgtgctggccagttgtgtcggcccggtgaccgccgagccgttggtc
cgccggggcgtgccggtgagcgcgccgagccgggcccggttgggtgcgctggtgcgcacc
atcgtcgacgaactgccccgccgtacggtcaccatcaaggtcgccggacatctgctcacg
ctgcgcgggcacgccgccgtgatcgacggggagctgcgtccgttggcgccggcgccgatg
gcggtgctgcgggcactggcccagtctccgggtcgggtgctgtcgcgtaccgccctgctg
cggacgctgccgcgcggtgccgacgagcacgccgtggagatggcggtggcccggctacgc
gccggtctgaaggctccccgggtggtgcagacggtcgtcaagcgcggctaccgcctccgc
gtcgactga

DBGET integrated database retrieval system