KEGG   Verrucosispora maris: VAB18032_01395Help
Entry
VAB18032_01395    CDS       T01471                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
vma  Verrucosispora maris
Pathway
vma00330  Arginine and proline metabolism
vma00332  Carbapenem biosynthesis
vma01100  Metabolic pathways
vma01130  Biosynthesis of antibiotics
vma01230  Biosynthesis of amino acids
Module
vma_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VAB18032_01395
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    VAB18032_01395
Enzymes [BR:vma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     VAB18032_01395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Nucleotid_trans
Motif
Other DBs
NCBI-ProteinID: AEB47363
UniProt: F4FDF2
Position
5981733..5982842
Genome map
AA seq 369 aa AA seqDB search
MRDAVTTARRVVVKIGSSSLTTATGGLDDERLDALVDALDTRTVDGREVVLVSSGAIAAG
LAPLGLARRPRDLATQQAAASVGQGLLIGRYAAAFARHGRTVGQVLLTVDDVTRRAHYRN
AYRTLRKLLDLRAVPIVNENDTVATEEIRFGDNDRLAALVAALVDADLLVLLSDVDALWT
GNPSRPGARRIAEVRDESDLAGVDIGGTGRSGVGTGGMVTKVEAARIATGFGIPVVLTSA
TQAVAALAGEPVGTFFHPSSKRPAARLFWLAHATSPRGRLHLDPGAVAAVVGRRKSLLPA
GITAVDGAFTAGDPVDLVDTAGAPVARGLVNYDAVELPGLLGRSTADLAAALGPAYEREV
VHRDDLVLL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgacgcagtcaccacggcccgacgggtcgtcgtcaagatcggttcctcctcgttg
accaccgccaccggcgggttggacgacgagcgtctcgacgcgcttgtcgacgcgctcgac
acgcgtaccgtcgacggccgcgaggtggtgctcgtctcctccggcgcgatcgccgccggt
ctcgcgccgctcgggttggcccggcgtccgcgcgacctggccacccagcaggccgccgcg
agcgtcggccagggcctgctgatcggccggtacgccgccgcgttcgcgcggcacggtcgc
accgtcggccaggtgctgctgaccgtcgacgacgtgacccgacgggcgcactaccgcaac
gcgtaccgcaccctgcgcaagctgctcgacctgcgggccgtaccgatcgtcaacgagaac
gacacggtcgccaccgaagagatccgattcggcgacaacgaccggctggccgctctggtg
gccgcgctcgtcgacgccgacctgctggtgctgctctccgacgtcgacgccctctggacc
ggcaacccgtcgcgccccggcgcacgccgcatcgccgaggtacgcgacgagtcggacctg
gccggcgtcgacatcggcggcaccggccgctccggcgtcggcaccggcggcatggtgacc
aaggtcgaggcggcccggatcgccaccggattcggcatcccggtggtgctcacctccgcc
acgcaggccgttgcggcgctggccggtgaaccggtcggcaccttcttccaccccagctcc
aaacggccggcggcccggctgttctggctcgcccacgcgacctcgccccggggccggctg
cacctcgacccgggtgcggtcgccgccgtcgtcggccgacgcaagtcgctgctgccggcc
gggatcaccgccgtggacggggcgttcaccgccggggatcccgtcgacctggtcgacacc
gccggcgccccggtcgcccgaggactcgtcaactacgacgcggtcgagctgcccggcctg
ctcggacgctccaccgccgaccttgctgcggcgctcggcccggcgtacgaacgtgaggtc
gtccaccgcgacgacctcgtactgctgtag

DBGET integrated database retrieval system