KEGG   Verrucosispora maris: VAB18032_01900Help
Entry
VAB18032_01900    CDS       T01471                                 

Definition
(RefSeq) phosphoglycerate mutase 1 family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
vma  Verrucosispora maris
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VAB18032_01900
   01230 Biosynthesis of amino acids
    VAB18032_01900
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAB18032_01900
  Energy metabolism
   00680 Methane metabolism
    VAB18032_01900
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VAB18032_01900
Enzymes [BR:vma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     VAB18032_01900
Exosome [BR:vma04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   VAB18032_01900
  Exosomal proteins of melanoma cells
   VAB18032_01900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6082701..6083468)
Genome map
AA seq 255 aa AA seqDB search
MTASEGPTVGTLVLLRHGESDWNAKNLFTGWVDVDLTEKGENEARRGGELLREHNLLPDV
VHTSLLRRAIRTSELALNAADRHWIAVRRSWRLNERHYGALQGKDKKQTLEEYGEEQFML
WRRSYDTPPPPIADDDEWSQVGDPRYALLPTELMPRTECLKDVVERMLPYWYDSIVPDIL
AGRTVLVAAHGNSLRALVKHLDQISDEAIAKLNIPTGIPLRYDLDPLLRPQTLGGTYLDP
EAAKAAAAAVANQGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgacagctagcgagggacccaccgtcgggacgctggtcctgttgcggcacggcgagagc
gactggaacgccaagaacctcttcaccggctgggtcgacgtggacctgaccgagaagggt
gagaacgaggcgcgccgcggcggcgagctgctgcgcgaacacaacctgctgccggacgtg
gtgcacacgagcctgctgcgccgcgccatccggaccagtgaactggcgctcaacgcggcc
gaccggcactggatcgcggtgcgtcggtcgtggcggctcaacgagcggcactacggcgcc
ctgcagggcaaggacaagaagcagaccctggaggagtacggcgaggagcagttcatgctc
tggcgccgctcctacgacaccccgcccccacccatcgccgacgatgacgagtggtcccag
gtgggcgacccgcggtacgcgctgctgccgaccgagctgatgccccgtacggagtgcctc
aaggacgtcgtcgagcggatgctgccgtactggtacgactcgatcgtgccggacatcctg
gccggccggacggtgctggtggcggcgcacggcaactcgctgcgcgccctggtcaagcac
ctggaccagatcagcgacgaggcgatcgccaagctgaacatcccgaccgggattccgctg
cgctacgacctcgacccgctgctgcgtccgcagaccctgggcggcacctacctcgacccg
gaggcggccaaggcggccgccgccgccgtcgccaaccagggccgctga

DBGET integrated database retrieval system