KEGG   Verrucosispora maris: VAB18032_02855Help
Entry
VAB18032_02855    CDS       T01471                                 

Definition
gtp cyclohydrolase i
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vma  Verrucosispora maris
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vma00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6281949..6282416)
Genome map
AA seq 155 aa AA seqDB search
MARAYAELFAGLRVDPATVLTTTFEANHEELVLVRDIDVMSLCEHHLLPFRGSAHIGYIP
GPDGRITGLSKLARLVEVYARRPQVQERLTSQIADLLMDRLAPRGVVVVLECEHMCMAMR
GIQKSGAKTITSAVRGTLQRDAKSRAEAMALIHPR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgcgcctacgccgaactcttcgccggcctgcgggtcgacccggccaccgtgctc
accaccaccttcgaggccaaccacgaggaactcgtgctggtccgggacatcgacgtgatg
agcctctgcgagcaccacctcctgccgttccggggcagcgcccacatcggctacatcccc
ggcccggacgggcggatcaccggcctgtccaagctggcccgactggtcgaggtctacgcc
cgccggccgcaggtgcaggaacggctcacctcgcagatcgcggacctgctgatggaccgg
ctcgcaccgcgcggggtggtggtcgtactcgaatgcgagcacatgtgcatggccatgcgc
ggcatccagaagtccggtgccaagacgatcacctcggcggtgcgtggcacgctccagcgg
gacgccaagtcccgtgccgaggcgatggcgctcatccatccccgctga

DBGET integrated database retrieval system