KEGG   Verrucosispora maris: VAB18032_03110Help
Entry
VAB18032_03110    CDS       T01471                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vma  Verrucosispora maris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VAB18032_03110
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VAB18032_03110
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VAB18032_03110
Enzymes [BR:vma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VAB18032_03110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
6343864..6345057
Genome map
AA seq 397 aa AA seqDB search
MTDLTVLPNGSLMADPGERGRFGGHGGRFVPESLIPACAELEEAFREAWADQRFRRDLDR
LLAVYAGRPTALTPAWRLSAELGINVLLKREDLAHTGSHKINNVLGQALLARRMGKTRLI
AETGAGQHGVATATAAALLGLEATVYMGAKDVERQALNVFRMELLGAEVIPVTGGSRTLK
DATSEALRHWVTRVDDTHYCIGSVMGPHPYPWIVRELQRVVGEEARAQCAAELRTGVPDY
VVACIGGGSNAAGTFAGFVDTPAQLIGVEAEGGAAVAFGRVGVLHGFRSYVLQDEDGQVS
EAHSIAAGLDYPGIGPEHAFLNDSGRARYVTVSDEEVIPAVRRLARTEGILPALESAHAI
AWVIRAAESGELPPFCTVLVTLSGRGDKDIHTIREAA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgacggacctgaccgtgctgcccaacggcagcctcatggccgatcccggcgagcgcggc
aggttcggtgggcacggtggccgcttcgtgcccgagtcgctgatccccgcctgcgccgag
ctggaggaggcgttccgggaggcgtgggcggatcagcgcttccgccgcgacctcgaccga
ctgctcgccgtgtacgccggccgcccgaccgcactcaccccggcctggcggctctccgcc
gagctcggcatcaacgtgctgctcaagcgggaggacctcgcccacaccggctcgcacaaa
atcaacaacgtgctcggtcaggccctgctggcgcgccggatgggcaagacgcggttgatc
gccgagaccggtgccggccagcacggcgtcgcgacggccaccgccgccgcgctgctcggc
ctggaagcaaccgtctacatgggggccaaggacgtcgagcggcaggcactcaacgtgttc
cggatggaactgctcggtgccgaggtcattccggtcaccggcggcagccgcactctcaag
gacgccacaagcgaggccctgcggcactgggtcacccgggtcgacgacacccactactgc
atcggctccgtgatgggcccgcacccgtacccgtggatcgtgcgggagttgcagcgggtc
gtgggtgaggaggcccgcgcacagtgcgccgccgagctgcggaccggcgtgcccgactac
gtggtggcctgcatcggcggcggctcgaacgccgccggcaccttcgccggcttcgtcgac
accccggcgcagctcatcggcgtggaggccgagggtggggcggcggtcgccttcggccgg
gtcggtgtgctgcacggcttccgctcgtacgttctgcaggacgaggacggtcaggtcagc
gaggcgcactcgatcgcggccgggctcgactacccgggcatcggcccggagcacgccttc
ctcaacgactccgggcgggcccgctacgtcacggtcagcgacgaggaggtcatcccggcg
gtacggcgactggcccgcaccgaggggatcctgccggccctcgaatcggcccacgccatc
gcctgggtgatccgggccgccgagagcggcgaactgccccccttctgcaccgtgctggtc
accctgtccgggcgcggcgacaaggacatccacaccattcgggaagcggcatga

DBGET integrated database retrieval system