KEGG   Verrucosispora maris: VAB18032_03115Help
Entry
VAB18032_03115    CDS       T01471                                 

Definition
tryptophan synthase
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vma  Verrucosispora maris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VAB18032_03115
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VAB18032_03115
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VAB18032_03115
Enzymes [BR:vma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VAB18032_03115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6345054..6345803
Genome map
AA seq 249 aa AA seqDB search
MSGKLLVPYVTGGIRPDWTRYVEEYARHGADMIEIGLPFSDPILDGPTIQQASHHALQQG
VTVRSILDDLTGLNVDVPLIAMTYYNLVIHNPSFCADLAAAGVSGLIVPDVPIDEVDELE
ATATAAGVDLVLLAAPTTTPSRLAAIAQRSRRFVYAVSVMGTTGERDRLGEDALRLAREL
RAMTDLPVLLGFGISQPAHAVAAADAADGVVVASALMRMVLDGAGPEEIGATIAEFRAAL
DGVVVGVGG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaaactcctggttccctacgtgaccggcggcatccgacccgactggacccgg
tacgtcgaggagtacgcgcgccacggcgccgacatgatcgagatcgggctcccgttctcc
gacccgatcctcgacggaccgacgatccagcaggcgtcgcaccacgccctccaacagggc
gtcacggtgcgttccatcctcgacgacctcaccggcctgaacgtcgacgtaccgctcatc
gcgatgacgtactacaacctggtgatccacaacccgtcgttctgcgccgatctcgccgcg
gccggcgtcagcgggctgatcgtgcccgacgtgccgatcgacgaggtggacgagctggag
gcgacggccacggcggccggggtcgacctcgtcctgctcgccgcgcccaccaccaccccg
tcgcggctggccgccatcgcgcagcgcagtcgacgcttcgtctacgccgtgtccgtcatg
ggcaccaccggtgagcgtgaccggctcggcgaggacgccctccggctcgcccgtgagctg
cgggccatgaccgacctgccggtgctgctcggcttcggcatctcgcagcccgcccatgcg
gtggcggccgccgacgccgccgacggtgtcgtggtggcgtcggcgctgatgcggatggtg
ctcgacggtgccggccccgaggagatcggtgccacgatcgcggagttccgggcggcgctg
gacggcgtggtcgtgggagtcggcgggtaa

DBGET integrated database retrieval system