KEGG   Verrucosispora maris: VAB18032_03115Help
Entry
VAB18032_03115    CDS       T01471                                 

Definition
(GenBank) tryptophan synthase
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vma  Verrucosispora maris
Pathway
vma00260  Glycine, serine and threonine metabolism
vma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vma01100  Metabolic pathways
vma01110  Biosynthesis of secondary metabolites
vma01130  Biosynthesis of antibiotics
vma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VAB18032_03115
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VAB18032_03115
Enzymes [BR:vma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VAB18032_03115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: AEB47707
UniProt: F4FI14
Position
6345054..6345803
Genome map
AA seq 249 aa AA seqDB search
MSGKLLVPYVTGGIRPDWTRYVEEYARHGADMIEIGLPFSDPILDGPTIQQASHHALQQG
VTVRSILDDLTGLNVDVPLIAMTYYNLVIHNPSFCADLAAAGVSGLIVPDVPIDEVDELE
ATATAAGVDLVLLAAPTTTPSRLAAIAQRSRRFVYAVSVMGTTGERDRLGEDALRLAREL
RAMTDLPVLLGFGISQPAHAVAAADAADGVVVASALMRMVLDGAGPEEIGATIAEFRAAL
DGVVVGVGG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaaactcctggttccctacgtgaccggcggcatccgacccgactggacccgg
tacgtcgaggagtacgcgcgccacggcgccgacatgatcgagatcgggctcccgttctcc
gacccgatcctcgacggaccgacgatccagcaggcgtcgcaccacgccctccaacagggc
gtcacggtgcgttccatcctcgacgacctcaccggcctgaacgtcgacgtaccgctcatc
gcgatgacgtactacaacctggtgatccacaacccgtcgttctgcgccgatctcgccgcg
gccggcgtcagcgggctgatcgtgcccgacgtgccgatcgacgaggtggacgagctggag
gcgacggccacggcggccggggtcgacctcgtcctgctcgccgcgcccaccaccaccccg
tcgcggctggccgccatcgcgcagcgcagtcgacgcttcgtctacgccgtgtccgtcatg
ggcaccaccggtgagcgtgaccggctcggcgaggacgccctccggctcgcccgtgagctg
cgggccatgaccgacctgccggtgctgctcggcttcggcatctcgcagcccgcccatgcg
gtggcggccgccgacgccgccgacggtgtcgtggtggcgtcggcgctgatgcggatggtg
ctcgacggtgccggccccgaggagatcggtgccacgatcgcggagttccgggcggcgctg
gacggcgtggtcgtgggagtcggcgggtaa

DBGET integrated database retrieval system