KEGG   Verrucosispora maris: VAB18032_03700Help
Entry
VAB18032_03700    CDS       T01471                                 

Definition
glycoside hydrolase family protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
vma  Verrucosispora maris
Brite
Enzymes [BR:vma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     VAB18032_03700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6500016..6502370
Genome map
AA seq 784 aa AA seqDB search
MLPTLAHAAESTLGAAANQSGRYFGAAVAANKLNDGAYTTILNREFNSVTPENEMKIDAT
EPQQNNFTFGNADRIVNHALSRGWKVRGHTLAWHSQQPAWMERMEGQALRSAMLNHVTRV
ATYYRGKIDSWDVVNEAFEDGNSGARRNSNLQRTGGDWIEAAFRAARAADPGAKLCYNDY
NTDNWTWAKTQAVYNMVRDFKQRGVPIDCVGFQSHFNAQSAYNSNYRTTLSSFAALGVDV
QITELDIEGSGSTQANTYRAVVNDCLAVPRCNGITVWGIRDSDSWRSYGTPLLFDNNGNK
KQAYTATLDALNSATPGPTPTPTTPGPTPTPTPPPSGSANEIVGNQSGRCIDVPNASQSN
GTRVQLYDCNKQTNQAWTYTANRQLQVYGNMCLDAAGTGNGAAVQIYSCHTGTNQQWNVN
SNGTISGVQSGRCLDVWSTSNGAQVQLYDCHTGANQQFRLVSLGGSNPPPTTPPPTTPPP
GTSCDLPSSYRWSSTGALAQPRSGWVSLKDFTHAPYNGQHLVYATTHDTGTTWGSMNFGL
FSNWNQMGSASQNQMPFAAVAPSLFYFAPRNIWVLAYQWGGPAFSYRTSTDPTNVNSWSS
AQTLFTGSISNSSTGPIDQALIGDDQNMYLFFAGDNGRIYRASMPIGNFPGSFGSNYTTI
MTDTTNNLFEGVQVYKLQGQQRYLMIVEAIGSQGRYFRSFTATSLGGTWTPQATSESNPF
AGKANSNATWTNDISHGELIRSNADQTMTVDPCNLQLLYQGRSPNSGGDYGLLPYRPGVL
TLQR
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccactctggcccacgctgccgagtccaccctcggtgcggccgcgaaccagtcc
ggccggtacttcggtgccgccgtggcggctaacaagctcaacgacggcgcgtacacgacg
atcctgaaccgcgagttcaacagcgtcacgcccgagaacgaaatgaagatcgacgcgacc
gagccgcagcagaacaacttcacgttcggcaacgcggaccggatcgtcaaccacgccctt
tcccggggctggaaggtccggggtcacaccctggcctggcactcgcagcagcccgcctgg
atggagcggatggaaggccaggcgctgcgctcggccatgctcaaccacgtcacccgggtc
gcgacctactaccgcggcaagatcgactcgtgggacgtggtgaacgaggcgttcgaggac
ggcaacagcggcgcgcgccgtaactccaacctccagcgcaccggcggggactggatcgag
gccgcgttccgcgccgcccgcgccgccgatccgggcgcgaagctctgctacaacgactac
aacaccgacaactggacctgggccaagacccaggccgtctacaacatggtgcgcgacttc
aagcagcgcggcgtaccgatcgactgcgtaggcttccagtcgcacttcaacgcccagtcg
gcgtacaacagcaactaccgcaccacgctgtccagcttcgccgccctcggggtggacgtg
cagatcaccgagctggacatcgagggttcgggcagcacccaggccaacacctaccgcgcc
gtggtcaacgactgcctggcagtcccccgctgcaacggcatcaccgtgtggggcatccgg
gacagcgattcctggcgttcctacggcacgccgctgctgttcgacaacaacggcaacaag
aagcaggcgtacacggccaccctggacgcgctgaacagcgccacccccgggccgaccccc
acgccgaccactccgggaccgaccccgaccccgaccccgcctccatccggctccgccaac
gagatcgtcggcaaccagtcgggccggtgcatcgacgtaccgaacgcgtcacagagcaac
ggcacccgcgtccagctctacgactgcaacaagcagaccaaccaggcctggacctacacc
gccaacaggcaactccaggtgtacggcaacatgtgcctggacgccgccggcaccggcaac
ggcgcagccgtacagatctacagctgccacaccggcaccaaccagcagtggaacgtcaac
tccaacggcaccatcagcggagtccagtccgggcgctgcctcgacgtctggagcacctcc
aacggcgcccaggtccagctctacgactgccacaccggtgccaaccagcagttccggctc
gtctccctcggcggttccaacccgccgccgaccaccccgccgccgacgactccgccgccc
ggcaccagctgtgacctgccgtcgtcgtaccggtggtcgtcgaccggcgctctcgcgcag
ccgaggtccggttgggtctcgctgaaggacttcacgcacgccccgtacaacggtcagcac
ctggtctacgccaccacccacgacacgggtacgacctggggttcgatgaacttcggcctg
ttctccaactggaaccagatgggctcggccagccagaaccagatgccgttcgccgccgtc
gcgccgtcgttgttctacttcgcgccgcgcaacatctgggtcctcgcctaccagtggggt
ggaccggcgttctcgtaccggacctcgaccgaccccaccaacgtcaacagctggtcgtcg
gcccagacgctgttcaccgggtcgatctccaactccagcaccggcccgatcgatcaggcg
ttgatcggtgacgaccagaacatgtacctgttcttcgccggcgacaacggccgcatctac
cgggccagcatgccgatcgggaacttccccggcagcttcggctccaactacaccacgatc
atgaccgacaccacgaacaacctgttcgagggcgttcaggtgtacaagctccagggtcag
cagcgctacctcatgatcgtcgaggcgatcggctcgcagggccgctacttccggtccttc
acggccaccagcctcggtgggacgtggaccccgcaggccacctccgagagcaacccgttc
gcgggcaaggccaacagcaacgcgacctggaccaacgacatcagccacggcgaactcatc
cgcagcaacgccgaccagacgatgaccgttgacccctgcaacctgcaactgctctaccaa
gggcggtcccccaactcgggcggcgactacggcctcctgccctaccgcccgggagtactg
actctgcagcgctga

DBGET integrated database retrieval system