KEGG   Verrucosispora maris: VAB18032_03960Help
Entry
VAB18032_03960    CDS       T01471                                 

Definition
DNA-formamidopyrimidine glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
vma  Verrucosispora maris
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:vma00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    VAB18032_03960
Enzymes [BR:vma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     VAB18032_03960
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     VAB18032_03960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6553173..6554033
Genome map
AA seq 286 aa AA seqDB search
MPELPEVEALAGYLRQRAVGRRVERLEAVAISALKTYDPALTAVTGRSVTDARRHGKFLD
VVFDGDLHLVVHLARAGWLHYREAFASTVPLRPGKGPIALRARLDDGSGFDLTEAGTQKK
LAVYLVTDPQAVPGVAKLGPDALSADLAAFAGALRSRRGQLKGVLTDQAVLAGVGNAYSD
EILHAAKLSPFALTDRLTDDQMATLHAATRRVLGDAVTRSLGQRAAELKGEKRSGLKVHA
RTGLPCPVCGDTVREVSFADSSLQYCPTCQTGGKPLADRRLSRLVR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactaccggaggtggaggcgctcgcgggttacctgcgacagcgcgcggtgggc
cgccgcgtcgagcggttggaggccgtcgcgatcagcgccctgaagacgtacgatccggcg
ctgaccgcggtcaccggccggtcggtgaccgacgcccgccggcacggcaagttcctcgac
gtcgttttcgacggtgacctgcacctggtggtgcacctggcgcgggccggctggctgcac
taccgggaggcgttcgcctcgaccgtcccgctccgaccgggcaagggcccgatcgcgctg
cgggcccgtctggacgacggttccggtttcgacctgaccgaggccggtacgcagaagaag
ctcgccgtgtacctggtgaccgatccgcaggcggtgcccggagtggccaagctcggcccg
gacgcgctctcggccgatctggccgccttcgccggggcactgcggagccgccggggacag
ctcaagggggtgctcaccgatcaggcggtgctggccggggtgggcaacgcgtactcggac
gagatcctgcacgcggcgaagctgtcaccgttcgccctgaccgaccgactcaccgacgac
cagatggcgacgctgcacgcggccacccgacgggtgctcggcgacgcggtcacccgctca
ctggggcagcgggccgcggaactgaagggtgagaagcgctccgggctgaaggtgcacgcc
cgtacgggactgccctgcccggtctgcggcgacaccgtgcgtgaggtttccttcgccgat
tcgagcctccagtactgcccgacctgtcagaccggcggcaagccccttgctgaccgaagg
ctgtccagacttgtacggtga

DBGET integrated database retrieval system