KEGG   Verrucosispora maris: VAB18032_04585Help
Entry
VAB18032_04585    CDS       T01471                                 

Definition
putative kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
vma  Verrucosispora maris
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    VAB18032_04585
Enzymes [BR:vma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     VAB18032_04585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
13021..13581
Genome map
AA seq 186 aa AA seqDB search
MRGVILYGPPAAGKDTVTTALHDLDARFTLYQRMKVGPGRTTGYRITDAATLDQLHQRGE
VVWENHRYGARYVVDRPSLVEQLSVGVPVVHLGQRAAVAAVTAAVSDARWLVVYLWCPRD
VAEQRIISRHTGDTAARLRAWDDTEPLAERDLFLNTAEMSPRTAAEVIHRHVLDDIRPAI
SKSDAG
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggcgtaatcctgtacggcccgcccgcggccggtaaggacaccgtgaccaccgcc
ctgcatgacctcgacgcccgcttcactctctaccagcgcatgaaggtcggaccgggacgc
accaccggctaccggatcaccgacgcagcgacacttgaccagctgcaccagcgtggcgaa
gtcgtctgggagaaccaccggtacggcgcccgttacgtggttgaccgcccatcgctggta
gagcagctttcggtcggggtgccggtcgtgcacctgggccagcgtgccgccgtcgctgcg
gtcacggccgccgtttccgatgcccggtggttggttgtctacctctggtgcccgcgagac
gttgccgagcagcggatcatctcccggcacactggcgacacagccgcacgtctccgcgca
tgggacgacaccgaaccactagccgagcgtgacctcttcctgaacaccgccgagatgtcg
ccacgtacggcggccgaggtcattcaccgccacgtcctggacgacatccgcccagcgata
tccaagagcgacgccggatga

DBGET integrated database retrieval system