KEGG   Verrucosispora maris: VAB18032_05030Help
Entry
VAB18032_05030    CDS       T01471                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vma  Verrucosispora maris
Pathway
vma00010  Glycolysis / Gluconeogenesis
vma00020  Citrate cycle (TCA cycle)
vma00620  Pyruvate metabolism
vma01100  Metabolic pathways
vma01110  Biosynthesis of secondary metabolites
vma01120  Microbial metabolism in diverse environments
vma01130  Biosynthesis of antibiotics
vma01200  Carbon metabolism
Module
vma_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAB18032_05030
   00020 Citrate cycle (TCA cycle)
    VAB18032_05030
   00620 Pyruvate metabolism
    VAB18032_05030
Enzymes [BR:vma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VAB18032_05030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: AEB42132
UniProt: F4FA71
Position
complement(104273..105733)
Genome map
AA seq 486 aa AA seqDB search
MSRIKEFNLPDLGEGLTEGEILAWLVKVGDTIELNQPIVEVETAKAAVEIPAKWAGQVQA
IFHPEGTTVEVGTPIIAIDTDPGAGPVESSTEELPAPSAASLAAVDIAPAEGAVEPGLIG
GPAPGGRTAVLVGYGPRTTAAKRRPRKGAAPAQATTAPVTPAAPAPVVAAPVPVQAAPVP
TVNGNGHPGGPVLAKPPVRKLAKDLGVDLRTLTGSGPLGSITREDVQQAVAASSAAAEPL
TVGAAATSAASFGADREQRIPVKGVRKLTAENMSRSAFTAPHVTEFLTIDMTRAMKALDR
LRGRREWRDVRVSPLLLVAKAVLLAVKRHPMVNSTWAGDEIVVKEYVNLGIAAATERGLI
VPNIKDAGRLTLRELADAMTDLVQTAKAGRTSPAAMSGGTLTITNVGVFGVDTGTPILPP
GESAILAFGAVREQPWVHKGKVKPRMVTTLALSFDHRIIDGELGSKFLRDIGDFLTDPEA
ALLAWT
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggatcaaggagttcaaccttcccgacctgggggagggcctgaccgagggcgag
atcctcgcctggctggtcaaggtgggcgacaccatcgagctgaaccaaccgatcgtcgag
gtggagaccgccaaggcggcggtggagatccccgcgaagtgggccggtcaggtgcaggcg
atcttccacccggagggcaccacggtcgaggtcggtacgccgatcatcgcgatcgacacc
gacccgggcgccgggccggtcgagtcctcgaccgaggaactgcccgcgccctcggcggcg
tcgctggccgccgtcgacatcgctccggcagagggcgcggtcgagccgggcctgatcggc
ggtcccgcaccgggcggtcgtaccgccgtcctggtcggctacggcccgcgcaccaccgcc
gcgaagcgccgtccccgcaagggcgcggccccggcccaggccaccaccgccccggtcacc
ccggccgcgccggccccggtcgtcgcggctccggtgccggtgcaggccgcgccggtgccg
acggtgaacggcaacggtcaccccggcggtccggtgctggccaagccgccggtacgcaag
ctcgccaaggatctcggcgtcgacctgcgtacgctgaccggctcgggcccgctcggctcg
atcacccgggaggacgtccagcaggcggtggcggcgtcgtcggctgcggccgagccgctg
acggtcggcgcggcggccacctccgccgcgagcttcggtgccgaccgcgagcagcgcatc
ccggtgaagggggtacgcaagctcaccgccgagaacatgtcccgctcggcgttcaccgcc
ccgcacgtcaccgagttcctcaccatcgacatgacccgggcgatgaaggcgctggaccgg
ctgcgtggccggcgggagtggcgcgacgtacgggtctcgccgctgctgctggtggcgaag
gcggtgctgctggcggtcaagcgacacccgatggtcaactcgacctgggccggcgacgag
atcgtcgtcaaggagtacgtcaacctgggcatcgcggcggccaccgagcgcggcctgatc
gtgccgaacatcaaggatgccggccggctgaccctgcgggagttggcggacgcgatgacg
gacctggtgcagaccgccaaggccggcaggacctcgccggctgccatgtcgggcggcacg
ctgaccatcaccaacgtcggtgtgttcggggtggacaccgggaccccgatcctgccgccg
ggggaatcggcgatcctggccttcggggcggtgcgcgagcagccctgggtgcacaagggc
aaggtgaaaccacgcatggtgaccacgctcgcgctctccttcgaccaccggatcatcgac
ggtgagctgggttcgaagttcctgcgcgacatcggtgacttcctcaccgaccccgaggcg
gcactgctcgcctggacctga

DBGET integrated database retrieval system