KEGG   Verrucosispora maris: VAB18032_07860Help
Entry
VAB18032_07860    CDS       T01471                                 

Definition
putative arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
vma  Verrucosispora maris
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VAB18032_07860
  Amino acid metabolism
   00330 Arginine and proline metabolism
    VAB18032_07860
Enzymes [BR:vma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     VAB18032_07860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(710690..711577)
Genome map
AA seq 295 aa AA seqDB search
MRSITVLDAPSNLGLRAPAPGLVPGCYKLAGALRDQRLLDRLGAHDGGVVVPPRYDIRGW
RPGDGVLNADALATYTRRLAERVNVVLDNAGFLMLLGGDCSILFGAALALRRRGRYGIAY
LDGSIDFRHTGNSTYVGASAGEGTAIVTGRGQPDIADIDGLAPYCREDDLVVLGVRDYDD
HLHEVRGLGITVHTAPEIIAEGPVLVGDRVAQGLARCDGYFVHLDADVLDPAVMPAADAP
DPGGLDHPHLVELLRPLLANPACVGLEVTIYDPDLDPDGRYAAALVETLVDALRS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcgatcacggttcttgacgccccgtccaatctcgggttgcgtgccccagcccct
ggtctcgtccccgggtgttacaagctggccggtgcgcttcgagatcagcgcctgctcgac
cggctcggagcgcacgacggcggtgtggtcgtcccgccgcgctacgacatccgtggctgg
cggccgggggacggtgtactcaacgccgacgccctcgcgacgtacacgcgccgactcgcg
gagcgggtgaacgtggtcctcgacaacgcaggcttcctgatgctgttgggcggtgactgt
tcgatccttttcggggccgcgctcgcgctacgccgacgtggccgctacggcatcgcctac
cttgacggttcgattgacttccgtcataccggcaacagcacgtatgtgggggcgtccgca
ggcgagggtaccgccatcgtcaccggccggggtcagccggacattgccgacatcgacggg
cttgcgccgtactgccgtgaggacgatctggttgtcctgggcgtccgcgactacgacgac
catctccacgaggtgcgtggtctgggcatcacggtgcataccgcgcccgagatcatcgcc
gagggccctgtcctggtcggcgatcgtgtggcacagggacttgcccgctgcgacggctac
ttcgtacacctcgacgccgatgtgctcgaccctgcggtgatgccggccgccgacgcgccc
gaccccggcggcttggaccatccgcatctggtggaactgctccgtccgctgctcgcgaac
ccggcctgtgtcggccttgaggtgacgatctacgacccggacctcgacccggacggccgc
tacgccgccgcgctcgtcgaaaccctggtcgacgccctgcgaagctga

  All links  
No link information was found.   
DBGET integrated database retrieval system