KEGG   Verrucosispora maris: VAB18032_08275Help
Entry
VAB18032_08275    CDS       T01471                                 

Definition
(GenBank) nucleotidyl transferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vma  Verrucosispora maris
Pathway
vma00040  Pentose and glucuronate interconversions
vma00052  Galactose metabolism
vma00500  Starch and sucrose metabolism
vma00520  Amino sugar and nucleotide sugar metabolism
vma01100  Metabolic pathways
vma01130  Biosynthesis of antibiotics
Module
vma_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VAB18032_08275
   00052 Galactose metabolism
    VAB18032_08275
   00500 Starch and sucrose metabolism
    VAB18032_08275
   00520 Amino sugar and nucleotide sugar metabolism
    VAB18032_08275
Enzymes [BR:vma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VAB18032_08275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: AEB42773
UniProt: F4F284
Position
787864..788817
Genome map
AA seq 317 aa AA seqDB search
MSEHSANPSAAAATGRPRAVKAVIPAAGLATRFLPATKAVPKELLPVVDRPVLQYIVEEA
AQAGIGDILLITGRGKTSMVDHFDRRPDLEERLAEKPDLLAAVKRTEELAAIYTCRQPEQ
LGLGHAVGYAESHVGDEPFAVLLGDEFVKPSEPLLPAMLELQARTGGVVLAFFEVDPAET
KRYGIASVEPAEAELTDIGEVVKVTGMVEKPTPEEAPSNLAVLGRYVLPGKIFDAIRRTR
PGSGGEIQLTDAMELLRTEGTPVHAIVYRGTRYDTGMPLGYLQTVVQIAAEREDLGSEFR
KWLAEFVNSDASGGRDT
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcactcagcgaacccctcagcggccgccgccaccggccgcccccgtgccgtc
aaggccgtgatcccggctgcgggcctggcgacccggttcctgccggccaccaaggcggtt
cccaaggaactgttgccggtcgtggaccggccggtgttgcagtacatcgtcgaggaggcc
gcgcaggccggcatcggcgacattctgctgatcaccggccgcggcaagacatcgatggtc
gaccacttcgaccgccggcccgacctggaggagcggctcgcggagaaacctgacctgctg
gccgccgtcaagcggaccgaagaactggcggccatctacacctgccggcagcccgagcag
ctgggtctcggccacgccgtcgggtacgccgagtcgcacgtcggtgacgagcccttcgcg
gtgctgctcggcgacgagttcgtcaagccctccgagccgctgctgccggccatgctggag
cttcaggcccgtaccggcggcgtggtgctggcattcttcgaggtcgacccggccgagacc
aagcggtacggcatcgcctcggtcgagccggcggaggccgagctgaccgacatcggcgag
gtcgtgaaggtcaccggcatggtcgagaagccgacgccggaagaggcgccgagcaacctc
gccgtgctgggccgctacgtcctgcccggcaagatcttcgatgccatccgtcgcacccgg
ccgggcagtggcggtgagatccagctgaccgacgcgatggaactgctgcggaccgagggc
accccggtgcacgcgatcgtctaccggggcacccgctacgacaccggcatgccgctgggc
tacctccagaccgtggtgcagatcgccgccgagcgcgaggacctgggcagcgagttccgc
aagtggcttgccgaattcgtcaactccgacgcgtcgggcggtcgggatacatga

DBGET integrated database retrieval system