KEGG   Verrucosispora maris: VAB18032_08275Help
Entry
VAB18032_08275    CDS       T01471                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vma  Verrucosispora maris
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:vma00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:vma00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:vma00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vma00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
787864..788817
Genome map
AA seq 317 aa AA seqDB search
MSEHSANPSAAAATGRPRAVKAVIPAAGLATRFLPATKAVPKELLPVVDRPVLQYIVEEA
AQAGIGDILLITGRGKTSMVDHFDRRPDLEERLAEKPDLLAAVKRTEELAAIYTCRQPEQ
LGLGHAVGYAESHVGDEPFAVLLGDEFVKPSEPLLPAMLELQARTGGVVLAFFEVDPAET
KRYGIASVEPAEAELTDIGEVVKVTGMVEKPTPEEAPSNLAVLGRYVLPGKIFDAIRRTR
PGSGGEIQLTDAMELLRTEGTPVHAIVYRGTRYDTGMPLGYLQTVVQIAAEREDLGSEFR
KWLAEFVNSDASGGRDT
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcactcagcgaacccctcagcggccgccgccaccggccgcccccgtgccgtc
aaggccgtgatcccggctgcgggcctggcgacccggttcctgccggccaccaaggcggtt
cccaaggaactgttgccggtcgtggaccggccggtgttgcagtacatcgtcgaggaggcc
gcgcaggccggcatcggcgacattctgctgatcaccggccgcggcaagacatcgatggtc
gaccacttcgaccgccggcccgacctggaggagcggctcgcggagaaacctgacctgctg
gccgccgtcaagcggaccgaagaactggcggccatctacacctgccggcagcccgagcag
ctgggtctcggccacgccgtcgggtacgccgagtcgcacgtcggtgacgagcccttcgcg
gtgctgctcggcgacgagttcgtcaagccctccgagccgctgctgccggccatgctggag
cttcaggcccgtaccggcggcgtggtgctggcattcttcgaggtcgacccggccgagacc
aagcggtacggcatcgcctcggtcgagccggcggaggccgagctgaccgacatcggcgag
gtcgtgaaggtcaccggcatggtcgagaagccgacgccggaagaggcgccgagcaacctc
gccgtgctgggccgctacgtcctgcccggcaagatcttcgatgccatccgtcgcacccgg
ccgggcagtggcggtgagatccagctgaccgacgcgatggaactgctgcggaccgagggc
accccggtgcacgcgatcgtctaccggggcacccgctacgacaccggcatgccgctgggc
tacctccagaccgtggtgcagatcgccgccgagcgcgaggacctgggcagcgagttccgc
aagtggcttgccgaattcgtcaactccgacgcgtcgggcggtcgggatacatga

DBGET integrated database retrieval system