KEGG   Verrucosispora maris: VAB18032_08470Help
Entry
VAB18032_08470    CDS       T01471                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
vma  Verrucosispora maris
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:vma00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
829340..830311
Genome map
AA seq 323 aa AA seqDB search
MRTGWHPVTEAWRPGDDDERRGATGPVRVRVPAKVNLHLGVGPLRRDGYHELNTVYHAIS
IYDELTARRGDTLTLTMEGEGTGELALDDSNLVIRAAHALAGYAGVMPHARLHLRKQIPL
AGGLAGGSADAAATLVACDALWGTGLSRDELADIAADLGSDVPFLIHGGTALGTGRGEAI
SPVLARPTSWHWVVAIADGGLSTPQAYRELDRLREAGAAGPALGSTDALLGALRQRDPRV
LARTLGNDLQDAALSLRPSLAATLKAGEAAGALAGIVSGSGPTCVFLAADAADAERVAAE
LTAAEVCRHVRTAHGPVHGARIT
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgcggacggggtggcatccggtgaccgaggcctggcgaccgggggacgacgacgaacgg
cgcggggccaccggaccggtccgggtccgggtgcccgccaaggtcaacctgcatctgggg
gtcggaccgttgcggcgggacggctaccacgagctgaacaccgtctaccacgcgatctcg
atctacgacgagctgaccgcgcggcggggcgacaccctcaccctcaccatggagggcgaa
ggcaccggggaactcgccctcgacgactcgaacctggtcatccgggccgcccacgcgctc
gccggttacgccggtgtgatgccgcacgcccgcctgcacctgcgcaagcagatccccctc
gccggcggcctcgccgggggcagcgcggacgcggccgccacgctggtggcctgcgacgcg
ctctggggcaccggcctgtcccgcgacgaactggccgacatcgccgccgacctcggctcg
gacgtgccgttcctgatccacggcggtaccgccctcggcaccggccggggcgaggcgatc
agccccgtcctggcccgccccacctcctggcactgggtggtggccatcgccgacggcggc
ctgtccaccccccaggcgtaccgcgaactcgaccggcttcgcgaggccggcgccgcgggg
ccggcgctcggcagcaccgacgccctgcttggcgcgttgcgccagcgcgaccctcgggtg
ctggcccggaccctcggcaacgacctgcaggacgccgccctgtccctgcgcccctccctg
gcggccacgctgaaggccggggaggcggccggcgccctggccggcatcgtctccggctcc
ggccccacctgcgtcttcctcgccgccgacgcggccgacgccgagcgggtcgccgccgag
ttgaccgccgccgaggtgtgccgccacgtccgcaccgcccacggcccggtccacggcgcc
cgcatcacctga

DBGET integrated database retrieval system