KEGG   Verrucosispora maris: VAB18032_08525Help
Entry
VAB18032_08525    CDS       T01471                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
vma  Verrucosispora maris
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    VAB18032_08525
Enzymes [BR:vma01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     VAB18032_08525
Transfer RNA biogenesis [BR:vma03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    VAB18032_08525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
841093..841896
Genome map
AA seq 267 aa AA seqDB search
MVDGEFARWLAARAGEALVGLRAELGFDDPAALKAAGDKVSHDLIRAELARWRPGDAVLS
EEDEGSRQASAAQGEAGVGSRLTADRVWIIDPLDGTREFSEQGRTDWAVHVALWARDASA
SHGLVAGAVGLPAQQRVLATDQPPAYPSVSVGGAGRLRLAASRSRPPAFLTDLAEEVGAQ
LVPMGSAGAKIAAVVTGEVDAYIHAGGQYEWDSAAPVAVATATGLHASRIDGSALKYNEA
DPRLPDLLVCREDLASRLLAALRRHGG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacggggagttcgcccgctggttggcggcccgggcgggtgaggcgctggtgggc
ctgcgggccgagttggggttcgacgatcccgccgcgttgaaggcggccggggacaaggtc
tcgcatgatctgatccgggccgagttggcgaggtggcgtccgggtgacgcggttctctcc
gaggaggacgagggttcccgtcaggcgtccgcggcgcagggcgaggcgggggtcgggtcc
cggttgaccgccgaccgggtgtggatcatcgacccgttggacggtacgcgggaattcagc
gagcaggggcgtacggactgggcggtgcacgtggcgttgtgggcgcgggacgcctcggct
tcccacggtctggtcgcgggtgctgtcgggttgccggcacagcagcgggtgttggcgacc
gaccagccgcccgcgtacccgtcggtgtcggtcggtggtgcgggccggttgcgcctggcg
gccagtcggagccgaccgccggcgttcctgaccgacctggccgaggaggtcggggcgcag
ttggtgccgatgggatcggccggggcgaagatcgccgcggtggtgaccggtgaggtggac
gcgtacatccacgcgggcgggcagtacgagtgggactcggcggcgccggtggctgtggcg
acggccaccggactgcacgcttcccggatcgacggttctgcgctgaaatacaacgaggcg
gacccccgtctgcctgatctgttggtgtgccgtgaggatctcgccagccggttacttgca
gcgctgcgccggcatggcgggtag

DBGET integrated database retrieval system