KEGG   Verrucosispora maris: VAB18032_08525Help
Entry
VAB18032_08525    CDS       T01471                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
vma  Verrucosispora maris
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:vma00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
841093..841896
Genome map
AA seq 267 aa AA seqDB search
MVDGEFARWLAARAGEALVGLRAELGFDDPAALKAAGDKVSHDLIRAELARWRPGDAVLS
EEDEGSRQASAAQGEAGVGSRLTADRVWIIDPLDGTREFSEQGRTDWAVHVALWARDASA
SHGLVAGAVGLPAQQRVLATDQPPAYPSVSVGGAGRLRLAASRSRPPAFLTDLAEEVGAQ
LVPMGSAGAKIAAVVTGEVDAYIHAGGQYEWDSAAPVAVATATGLHASRIDGSALKYNEA
DPRLPDLLVCREDLASRLLAALRRHGG
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacggggagttcgcccgctggttggcggcccgggcgggtgaggcgctggtgggc
ctgcgggccgagttggggttcgacgatcccgccgcgttgaaggcggccggggacaaggtc
tcgcatgatctgatccgggccgagttggcgaggtggcgtccgggtgacgcggttctctcc
gaggaggacgagggttcccgtcaggcgtccgcggcgcagggcgaggcgggggtcgggtcc
cggttgaccgccgaccgggtgtggatcatcgacccgttggacggtacgcgggaattcagc
gagcaggggcgtacggactgggcggtgcacgtggcgttgtgggcgcgggacgcctcggct
tcccacggtctggtcgcgggtgctgtcgggttgccggcacagcagcgggtgttggcgacc
gaccagccgcccgcgtacccgtcggtgtcggtcggtggtgcgggccggttgcgcctggcg
gccagtcggagccgaccgccggcgttcctgaccgacctggccgaggaggtcggggcgcag
ttggtgccgatgggatcggccggggcgaagatcgccgcggtggtgaccggtgaggtggac
gcgtacatccacgcgggcgggcagtacgagtgggactcggcggcgccggtggctgtggcg
acggccaccggactgcacgcttcccggatcgacggttctgcgctgaaatacaacgaggcg
gacccccgtctgcctgatctgttggtgtgccgtgaggatctcgccagccggttacttgca
gcgctgcgccggcatggcgggtag

DBGET integrated database retrieval system