KEGG   Verrucosispora maris: VAB18032_08630Help
Entry
VAB18032_08630    CDS       T01471                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
vma  Verrucosispora maris
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vma00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
865136..866383
Genome map
AA seq 415 aa AA seqDB search
MKRDGGVLSDSQIDWVVDAYTRGAVADEQMSALAMAILLNGMTAPEIARWTAAMIASGER
LDLSSVARPTVDKHSTGGVGDKITLPLTPLVAACGAAVPQLSGRGLGHTGGTLDKLESIP
GWRAALSNQEFIAQLRDIGAVICAAGSGLAPADRKLYALRDVTGTVEAIPLIASSIMSKK
IAEGTGALVLDVKVGSGAFMKSVDDARQLARTMVELGGAHGVKTVALLTDMSTPLGLTIG
NGVEVTESVEVLAGGGPADVVELTLALAREMLDAAGLTDADPAAALRDGRAMDVWRSMIR
AQGGDPDAPMPQAPEVEVVRADADGYVAGVDAYAMGVAAWRLGAGRARKEDPVSVPAGVV
LHKRPGDPVRAGEPLYELRAERAETIPAALAEAASAVTIEARPPAATPLVIERVE
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcgggacgggggggtgctctccgactcgcagatcgactgggtggtggatgcgtac
acccggggggcggtggccgacgagcagatgtcggcgctggccatggcgatcctgctcaac
gggatgacggcgccggagatcgcccggtggacggccgcgatgatcgccagcggtgagcgg
ctggacctgtcgtcggtggctcggccgacagtcgacaagcactcgaccggcggggtcggc
gacaagatcactctgccgttgacgccgctggtggcggcgtgcggcgcggcggtgccgcag
ctgtccgggcgcgggctcgggcacaccggcggcacgctggacaagctggagtccatcccc
gggtggcgggccgcgctgagcaaccaggagttcatcgcgcagctgcgcgacatcggcgcg
gtgatctgcgccgccgggtccggactggccccggccgaccgcaagctgtacgcgctgcgc
gacgtcaccggcaccgtcgaggcgattccgctgatcgccagttcgatcatgagcaagaag
atcgctgaggggaccggcgcgctggtgctcgacgtgaaggtcggctccggcgcgttcatg
aagtccgtcgatgacgcccggcagctggcccggaccatggtggagctgggtggcgcgcac
ggcgtgaagaccgtggccctgctcaccgacatgtccaccccgctcggcctgaccatcggc
aacggcgtcgaggtgaccgagtccgtcgaggtgctcgccggtggcggccccgccgacgtg
gtggagctgaccctggccctggcccgggagatgctcgacgcggccgggctgaccgacgcc
gacccggctgccgcgctgcgcgacgggcgggcgatggacgtgtggcggtcgatgatccgc
gcgcagggcggtgacccggacgcgccgatgccgcaggcgcccgaggtcgaggtggtccgg
gcggacgccgacggctacgtggcgggagtcgacgcgtacgccatgggggttgccgcctgg
cggctcggcgcggggcgggcccgcaaggaggacccggtgagtgtccctgccggtgtggtg
ctgcacaaacgtcccggtgatccggtgcgggccggcgagcctctgtacgagctgcgggcc
gagcgggccgagacgatcccggcggcgttggcggaggcggcgtcggcggtgaccatcgag
gcgcggccaccggcggcgacgcctttggtgatcgaacgcgtcgagtga

DBGET integrated database retrieval system