KEGG   Verrucosispora maris: VAB18032_09460Help
Entry
VAB18032_09460    CDS       T01471                                 

Definition
f420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
vma  Verrucosispora maris
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:vma00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1052579..1053667)
Genome map
AA seq 362 aa AA seqDB search
MKLEILPVPGIGHVTEGDDLAALIATAAPWLRDGDVLVVTSKIVSKAEGRLVDVPADGPE
RQAARDEILAAETARVVATRGATRIVQTRHGFVMASAGIDASNVDKTRLVLLPEDPDASA
RALRADLRDRYGVEVAVIISDTMGRPWRNGLTDVALGVAGMSAIRDHRGEVDPYGNELVL
TQMAVADELAGAGELIKGKCDQMPVAVIRGYLSATPPDDGEGARALVRDASMDLFALGTA
EATATGLAAAATIADRPGDTAPDPVAVDRAIAAVADVVTPGTVFTQVTDSDVRNGLVATV
AGWPAEATALVLCSPPTPVGPVQLVRFGADVQRLRTALAAHGVPSQLLPPPAHTTAVAAL
AL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggagatcctgccggtgcccggcatcggccacgtgactgagggcgacgacctg
gccgcactgatcgcgacggctgcgccctggctgcgcgacggcgacgtgctcgtggtgacc
agcaagatcgtgtccaaggcggagggccggttggtggacgtcccggccgacggcccggaa
cggcaggccgctcgggacgagattctcgcggccgagaccgcccgggtggtggccacccgg
ggcgcgacccggatcgtgcagacccggcacggcttcgtgatggcctcggccggcatcgac
gcctccaacgtcgacaagacgcggctggtcctgctccccgaggacccggacgcctcggcc
cgcgcgctccgtgccgacctgcgcgaccggtacggcgtggaggtggccgtcatcatcagc
gacaccatggggcggccctggcgtaacgggctgaccgatgtggccctcggcgtggccggg
atgagcgccatccgcgatcaccggggcgaggtcgatccgtacggcaacgagttggtgctg
acgcagatggcggtggccgacgagttggccggggcgggcgaactgatcaagggtaagtgc
gaccagatgccggtggcggtgatccgtggctacctgagcgcgaccccgcccgacgacggc
gagggagcccgggccctggtccgggacgcctcgatggacctgttcgcgctcggtaccgcc
gaggcgacggctaccgggctggccgctgccgccaccatcgccgaccgccccggtgacacc
gcccccgatccggtggctgtcgatcgggcgatcgccgcggtggcggacgtggtcactccc
ggcacggtcttcacccaggtcaccgacagcgacgtacgcaatggtctggtcgccaccgtg
gccggttggccggccgaggcgaccgctctggtgctctgctccccacccaccccggtcggc
ccggtgcagctggtgcgtttcggtgccgacgtgcagcgcctgcgcaccgccctcgcggcg
cacggcgtcccctctcaactcctcccaccgcccgcccacaccaccgccgtcgccgccctg
gccctctga

DBGET integrated database retrieval system