KEGG   Verrucosispora maris: VAB18032_09565Help
Entry
VAB18032_09565    CDS       T01471                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
vma  Verrucosispora maris
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vma00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1074265..1075278
Genome map
AA seq 337 aa AA seqDB search
MTRYGPMFGPDVTFLGVPPCTIEEPVTYADADVVIIGAPFDGGTSHRPGTRFGPSAIRQA
CYLPHDGSRPSLALRVDALKDLCVYDAGDVEMFSGDIDRSLAALETAVYAVTSAGAIPVI
LGGDHSIALPDATGVARHHGLGRVSLLHFDAHADTGDIEFGSLHGHGQPMRRLIESGAVR
GDRFLQIGLRGYWPGPETLRWMAEQRMRSYEMTEIVARGLDDCLSEAFDIATDECEGVFL
SVDVDVVDPGMAPGTGTPEPGGFTSRQLLDAVRRACYELPIVGVDVVEVAPPYDHADITA
YLGNRIVLEALSAIARRRHDATGTPPWTPTQPLLDSR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgacccgctacggcccgatgttcggccccgacgtcacattcctcggcgtgccaccctgc
accatcgaggaaccggtgacgtacgccgacgccgacgtggtcatcatcggcgcgcccttc
gacggcggcacctcacaccgccccggcacccggttcggcccgtcggccatccgccaggcc
tgctacctgccgcacgacggctcccgcccctccctggccctgcgcgtcgacgccctcaag
gacctgtgcgtgtacgacgccggtgacgtggagatgttctccggcgacatcgaccgctcc
ctggccgccctggaaaccgccgtgtacgcggtgacgtcggccggcgcgatcccggtgatc
ctcggcggcgaccactccatcgccctgcccgacgccaccggagtggcccgccaccacggg
ctcggccgggtgtcgctgctgcacttcgacgcccacgccgacaccggggacatcgagttc
ggctccctgcacgggcacggccaaccgatgcgtcgactcatcgagtccggcgcggtacgc
ggcgaccgcttcctccagatcggactgcgcggctactggccgggcccggagacgctgcgg
tggatggccgagcagcggatgcgctcgtacgagatgaccgagatcgtggcccggggcctg
gacgactgcctgtccgaggcgttcgacatcgccaccgacgagtgcgagggagtcttcctc
tccgtcgacgtggacgtggtcgacccgggcatggcacccggcaccggcacccccgagccc
ggtggcttcacctcccgccaactgctcgacgcggtccgccgggcctgctacgaactcccg
atcgtcggagtcgacgtggtcgaggtcgccccaccgtacgaccacgccgacatcaccgcc
tacctgggcaaccgcatcgtcctggaagccctctccgccatcgcccgccgccgccacgac
gccaccggcaccccaccctggacccccacccaacccctcctcgactcccgctga

DBGET integrated database retrieval system