KEGG   Verrucosispora maris: VAB18032_09855Help
Entry
VAB18032_09855    CDS       T01471                                 

Definition
magnesium chelatase, chli subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
vma  Verrucosispora maris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VAB18032_09855
Enzymes [BR:vma01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     VAB18032_09855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1151903..1153354
Genome map
AA seq 483 aa AA seqDB search
MSRFPATPVPPPDLPGTLGALRAAGCRYRTVKQELRDNLLARLRDGGPRFAGIVGYDDTV
LPEVERALLAGHDMVLLGERGQGKTRLIRSLVALLDEWTPVIAGSALNEHPLHPITPASR
ALVAEAGDDLPVGWLHRSMRYGEKLATPDTSVGDLIGDVDPIRLAQGRTLGDPETIHFGL
VPRTNRGIFAVNELPDLAERIQVALLNVLEERDIQVRGYQLRLPLDLFLVASANPEDYTN
RGRIITPLKDRFGAEIRTHYPTDLELELALIRQEADLVAEVPEHVLEVLARFARAVRESP
SVDPRSGVSARFAIAAAETVAAAALRRASLLADASTAEPFLAPEAVARVGDAVSVTSTLR
GKVEFESGEEGREIEILGHLLRTATAETFRARLAGLDLSGFTTLVEDGKAIETGELVPAT
DLLRQVGTVPGLAKVLDRLGVGDAPSAGQAAAAVEFVLEGLHLSRRLGKDVTDSGRTRYA
GRD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagatttccggcaactccggtcccgccacccgatctgcccggcacgctcggcgcg
ctacgcgccgccggatgccggtaccgcacagtcaagcaggagctgcgcgacaacctgctg
gcccggctgcgagacggcgggccgcggttcgccggcatcgtcgggtacgacgacacagtg
ctgcccgaggtggaacgggcgctgctcgccgggcacgacatggtgttgctcggtgagcgt
ggccagggcaagacccggctgatccgatccctggtggcgctgctggacgagtggaccccg
gtgatcgccggatcggcgctcaacgagcatcccctgcatccgatcaccccggcgtcccgg
gcgctggtcgccgaggccggcgacgacctgccggtcggctggctgcaccgctcgatgcgc
tacggcgaaaagctggccaccccggacaccagtgtcggtgacctgatcggtgacgtcgac
ccgatccggctggcgcagggaaggactctcggcgacccggagacgatccacttcggtctg
gtgccgcgtaccaaccggggtattttcgccgtgaacgagctgcccgacctggccgagcgg
atccaggtggcgttgctcaacgtgctggaggaacgcgacatccaggtacgcggctaccag
ctgcgactgccgctggatctgttcctggtggccagcgccaacccggaggactacaccaac
cgggggcggatcatcaccccgctcaaggaccggttcggtgccgagatccgtacccactat
ccgaccgacctggagttggaactggcgctgatccggcaggaggccgacctggtcgccgag
gtgccggaacacgtgctggaggtgctggcccgcttcgcccgcgcggtgcgcgagtcgccg
tcggtggatccccgctcgggcgtctccgcccggttcgccatcgccgctgcggagaccgtc
gccgccgccgcgctgcgccgcgccagcctgctcgccgacgcctccaccgccgagcccttc
cttgcgccggaggcggtggcgcgggtgggggacgcggtgtcggtgacctccacgctgcgc
ggcaaggtggagttcgagagcggtgaggagggccgggagatcgagatcctcggtcatctg
ctgcgtaccgccacggccgagaccttccgggcccggctggccgggctggacctgtccgga
ttcaccacgctggtcgaggacggcaaggcgatcgagaccggggaactggtcccggcgacc
gatctgctgcgtcaggtgggcaccgtacccggcctggcgaaggtgctcgaccggctcggc
gtcggtgacgcgccgagcgccgggcaggccgccgctgcggtcgagttcgtgctggaaggg
ctgcacctgagccgccggctgggcaaggacgtgacggattcggggcgcacccgctacgcc
ggccgggactga

DBGET integrated database retrieval system