KEGG   Verrucosispora maris: VAB18032_10930Help
Entry
VAB18032_10930    CDS       T01471                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vma  Verrucosispora maris
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VAB18032_10930
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    VAB18032_10930
Enzymes [BR:vma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     VAB18032_10930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1386193..1387644)
Genome map
AA seq 483 aa AA seqDB search
MRLDPGLRRLALGTLLAAYPGSTPPDWAVELVADGLAGHTLFGRNIDEPARVAASTAALR
TARADVLVGIDEEGGDVTRLAHATGSPYPGNAALGAIDDEALTRDIHRAIGGELAALGIT
VNLAPTVDVNSTDDNPVIGTRSFGADPARVAAHSAAAVAGLQAAGVAACAKHFPGHGATV
TDSHHELPTVDVPPEVLRRRDLPPFAAVIAAGTRAVMTAHIRVPALTGAAPATFSRAVLV
DLLRQEYGFTGAVITDALEMKGAALAAGGIAPGAVRALAAGADLLCIGAKVDAGLVERVA
TEIVTAVGDGRLARDRVEQAAGRAAELAAWTRDTGPTTVAAADLGYAAARRAVRVEGSLA
GLDHPLVVQVHARSTVVQGRVPWGLGPHLHGTELIEVVATEADPEELRRRAGNRPIVLVG
RRLHQLPGGPELVAALAGTHPVAVVEMGWPARWRPTGTRAFVITYGASHANGLAAAEVLG
LAG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgcggctggatcccggacttcgccggctcgccctgggcactctgctggccgcgtacccg
gggtcgaccccacccgactgggcggtcgagttggtcgccgacggactggccgggcacacc
ctgttcggccgcaacatcgacgaaccggcacgggtggcggcgagcactgccgcgttgcgc
accgctcgggccgacgtcctcgtgggcatcgacgaggagggcggcgacgtgacccggttg
gcgcacgccaccggcagcccgtatccgggcaacgcggcgctcggcgcgatcgacgacgag
gcgttgacccgggacatccaccgggccatcggcggggagttggcggcgctcggcatcacc
gtgaacctggcgcccaccgtcgacgtcaacagcaccgacgacaacccggtgatcggcacc
cggtcgttcggcgccgatccggcacgggtcgccgcacactccgccgccgcggtcgccggc
ctccaggccgccggggtggccgcctgcgccaagcacttccccgggcacggcgcgacggtg
accgactcccaccacgaactgcccaccgtggacgtgccgccggaggtgctgcgtcgccga
gacctgccgccgttcgccgcggtgatcgcggccggaaccagggcggtgatgaccgcccac
atccgggtaccggccctgaccggcgcggcgccggccacgttcagccgggccgtcctggtc
gacctgctccgccaggagtacggcttcaccggggcggtgatcaccgacgcgttggagatg
aagggtgccgcgctcgcggccggcgggatcgctcccggcgcggtacgcgccctggccgcc
ggcgcggacctgctctgcatcggcgccaaggtggacgccggcctggtcgaacgggtggcc
accgagatcgtcacggcggtgggcgacggccggctggcgcgggaccgggtcgagcaggcc
gccggacgtgccgcggaactggccgcgtggacccgcgacaccggcccgaccaccgtcgcc
gccgccgacctggggtacgcggcggcccgccgtgccgtccgggtggagggctcactggcc
gggttggaccatccgctggtggtacaggtgcacgcgcggtcgacggtcgtgcaggggcgg
gtgccgtggggtctcggcccgcacctgcacggcaccgagctgatcgaggtggtggccacc
gaggccgacccggaggagcttcggcggcgggccggcaaccggccgatcgtgcttgtcggc
cggcggctgcaccagttgcccggcgggccggagctggtcgccgcgctggccggtacgcat
ccggtggcggtggtcgagatgggctggccggccaggtggcggccgaccggcacgcgggcc
ttcgtcatcacctacggcgccagccacgccaacggtctagccgccgccgaggtgctgggt
ctggccggctga

DBGET integrated database retrieval system