KEGG   Verrucosispora maris: VAB18032_11480Help
Entry
VAB18032_11480    CDS       T01471                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
vma  Verrucosispora maris
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:vma03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1504477..1505334
Genome map
AA seq 285 aa AA seqDB search
MPELPEVETVRQGLARWVTGRRIESVEVRHPRAVRRHVAGGAHFADVLAGRTVLDVCRRG
KYLWLPLDSGDAVIGHLGMSGQLLLQPATAPEEPHLRVRFRFTDDGPELRFVDQRTFGGL
SVSEGGATLPAEIAHIARDPLDPQFSDADFVTAMRRRRTEVKRALLDQTLISGVGNIYAD
EALWRAGLHGTRPTDALTGPAVRRLLGHVRDVLTEAITAGGTSFDALYVNVNGQSGYFDR
SLNVYGREGQPCRRCGAPIRREAFMNRSSYSCPRCQPRPRATLRG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagctgcccgaggtggagaccgtccggcaggggctggcgcgttgggtcaccggc
cgacggatcgagtccgtcgaggtacgccacccgcgtgcggtgcgtcgacacgtggccggt
ggcgcccacttcgccgacgtgctggccggtcggaccgtgctcgacgtgtgccggcgcggc
aaatatctctggttgccgctggacagcggtgacgcggtgatcgggcatctcgggatgtcc
gggcagctgttgctgcaaccggccaccgccccggaggagccgcacctgcgggtccgcttc
cggttcaccgacgacggtcccgaactgcgcttcgtcgaccagcgtacgttcggtgggctc
tcggtcagcgagggcggcgcgacgctgcccgcggagatcgcccacatcgcccgggatccg
ctggatccgcagttctccgacgcggacttcgtcaccgcgatgcgccgccgccgtaccgag
gtcaagcgtgcgctgctcgaccagacgttgatctccggggtgggcaacatctacgccgac
gaggcgctgtggcgggccggactgcacggcacccgaccgaccgacgcgttgaccggcccg
gccgtacggcggttgctcggccacgtacgcgacgtgctgaccgaggcgatcacggcgggc
ggcaccagcttcgacgcgctgtacgtcaacgtcaacgggcagagcggttacttcgaccgg
tcgctgaacgtctacggccgcgaggggcagccctgtcggcgctgcggcgcgccgatccgt
cgggaggccttcatgaaccggtcgtcgtacagttgcccgcgctgccagccccgtccccgc
gccacgctgcgcggctga

DBGET integrated database retrieval system