KEGG   Verrucosispora maris: VAB18032_13125Help
Entry
VAB18032_13125    CDS       T01471                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
vma  Verrucosispora maris
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VAB18032_13125
Enzymes [BR:vma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     VAB18032_13125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1862685..1865078)
Genome map
AA seq 797 aa AA seqDB search
MDTALNPKSTLTDEELRRLDAYWRAANYLTVGQIYLLDNPLLREPLAPEHVKPRLLGHWG
TSPGLNLIYAHLNRVIVARDLSAIYITGPGHGGPALVANSWLEGTWSERYHGIDRDEAGM
ARLFRQFSFPGGIPSHVAAEVPGSIHEGGELGYALSHAYGAAFDNPDLLVACVIGDGEAE
TGPLSGSWLSNVFLNPARDGAVLPILHLNGYKIANPTVLDRIPESDLLDMMRGYGYQPYV
VAGDEPAAVHELLAATFDRALDEIAEIQRQARSGGTVTRPRWPMIVLRTPKGWTGPSEVD
GKQVEGTYRAHQVPLSQVRTNPAHRAELERWLRSYRPEELFDATGAPVAELTALPPTGDR
RMSANPVTNGGQVLRDLTLPDFRDYAVEVPRPGATVAGATGELGKWIRDVIVANPQTFRL
FGPDEVASNRLQAAFEVTDRAWMARTVPGDDHLSPDGRVMEVLSEHLCQGWLEGYLLTGR
HGIFTSYEAFIHIVDSMVNQHAKWLKVTRDIPWRLPVASLNYLLSSHVWRQDHNGFSHQD
PGFIDHVMNKKAEVVRVYLPPDANTLLSTMDHCLRSRHYINVVVAGKQSAPNWLTMTEAV
QHCRRGLGIWDWASTDGDSEPDVVLACAGDVPTLETLAAADLLRQHLPELKVRVINVVDL
MRLQPPSEHPHGLPDNEFDTLFTRDKPIIFAYHGYPWLIHRLTYRRTNHDNLHLRGYKEE
GTTTTPFDMVMLNDLDRFHLVIDVIDRVPGLAARAAHLRQEMTDARQSCRDYTRQYGEDD
PRVAEWRWVRETDQTNP
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atggacaccgccctgaatccgaagagcaccctgaccgatgaggagctgcgccggctggac
gcgtactggcgggcggcgaactacctgaccgtcggccagatctacctgctcgacaatccc
ctgctgcgcgagccactggcccccgaacacgtcaagccccggctgctcggccactgggga
acctcccccggcctgaacctgatctacgctcacctgaaccgggtgatcgtggcgcgggac
ctgtccgcgatctacatcaccggccccgggcacggtggtccggccctggtcgcgaacagc
tggttggaaggcacctggagcgagcggtaccacggcatcgaccgcgacgaggccgggatg
gcccggctgttccgccagttctccttccccggcggcatccccagccacgtggcggcggag
gtgccgggttcgatccacgagggcggcgagctggggtacgcgctgagccacgcctacggc
gcggccttcgacaacccggatctgcttgtcgcctgcgtgatcggtgacggcgaggccgag
accggcccgttgtcgggcagctggctgtccaacgtgttcctcaacccggcccgcgacggc
gcggtgctgcccatcctgcacctcaacggctacaagatcgccaacccgaccgtgctggac
cggatccccgagtccgacctgctcgacatgatgcgcggctacggctaccagccgtacgtg
gtggccggtgacgagcccgccgccgtgcacgagttgctggccgccacgttcgaccgggcg
ctcgacgagatcgcggagatccagcggcaggcccgctccgggggaaccgtcacccgtccg
cgctggccgatgatcgtgctgcgtacgccgaagggctggaccgggccgagcgaggtcgac
ggcaagcaggtcgaggggacgtaccgggcccaccaggttccgctgtcgcaggtacgcacg
aacccggcgcaccgggccgaactggagcgctggctgcgcagctaccggccggaggagctg
ttcgacgccaccggcgcaccggtcgccgagctgaccgcgctgccgcccaccggtgaccgg
cggatgagcgccaacccggtcaccaacggcgggcaggtgctgcgcgacctgaccctgccg
gacttccgcgactacgcggtcgaggtgccccgacctggtgcgacggtcgccggagccacc
ggtgagctgggcaagtggatccgcgacgtgatcgtcgccaacccgcagacgttccgactg
ttcggcccggacgaggtggcctccaaccggctccaggcggccttcgaggtcactgaccgc
gcctggatggcccgcaccgtccccggcgacgaccacctctcccccgacggccgggtgatg
gaggtcctctccgagcacctgtgccagggctggctggagggttacctgctcaccggccgg
cacggcatcttcaccagctacgaggcattcatccacatcgtggactcgatggtgaaccag
cacgccaagtggttgaaggtgacccgcgacatcccctggcggctgcctgtcgcgtcgctg
aactacctgctctccagccacgtctggcggcaggaccacaacggcttctcgcaccaggac
ccgggcttcatcgaccacgtgatgaacaagaaggccgaggtggtccgggtctacctgccg
ccggacgccaacaccctgctgtccaccatggatcactgcctgcgcagccggcactacatc
aacgtggtggtggccggtaaacagtccgcgccgaactggctgaccatgaccgaggccgtc
cagcactgccggcgcggcctggggatctgggactgggccagcaccgacggcgacagcgaa
ccggacgtggtgctcgcctgtgccggcgacgtaccgacgctggagaccctggccgcggct
gacctgctgcgccagcacctgcccgagctcaaggtacgggtgatcaacgtggtggacctg
atgcggctgcaaccgccgagcgaacacccgcacgggctgccggacaacgagttcgacacg
ctgttcacccgggacaagccgatcatcttcgcgtaccacggctacccgtggctgatccac
cggctcacctaccggcgtaccaaccacgacaacctgcacttgcgtgggtacaaggaggag
ggcaccaccaccactccgttcgacatggtgatgctcaacgacctggaccgattccacctg
gtgatcgacgtgatcgaccgggtgcccgggttggcggcccgcgccgcacacctgcgccag
gagatgaccgacgcccggcagtcctgccgcgactacacccggcagtacggcgaggacgac
ccccgggtcgccgagtggcgttgggtccgcgaaaccgaccagaccaacccgtag

DBGET integrated database retrieval system