KEGG   Verrucosispora maris: VAB18032_13660Help
Entry
VAB18032_13660    CDS       T01471                                 

Definition
iron-hydroxamate transporter permease subunit
Orthology
K02015  
iron complex transport system permease protein
Organism
vma  Verrucosispora maris
Pathway
ABC transporters
Module
Iron complex transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:vma02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1973872..1975980
Genome map
AA seq 702 aa AA seqDB search
MTELSAPPRSEPALGPAPAGRLSGTRVVGAFIAATALALVVAVVHLTQGTSAVGALDLLR
LLTGGDDETVRVLVASRMPRLLAGLAIGVALGFAGAALQSIARNPLASPDTLAVNAGAHL
AIVSVAAFGIALPALPAGGLAFCGGLAAAGLVMAMSSGGQAGTTRLILAGSATALALSSV
TMLLLLLFEQATIGLFAWGNGSLVQSDLNALTQLAPVIGLAIVALMLLGHRLDILALGDD
TATVLGLDVRRTRLIVTVLAVLLSAAAVTLTGPVGFVGLCAPVIVRLLGPLVPGVHRHRV
LLPLSGIAGMIIVLGSDVLLRAAMGAQAGVDIPTGVVTTLLGAAILIWLARRHRDAGPTR
RPPGGHAAVRSAGFHRTVVIVVATVAGVAVVVGMLAGDTWVLLGDLVNWVNGNTGPAYTF
VLDQRWPRVAAALLAGAALAVAGTTVQAVCRNPLAEPGILGITAGAGLGAVSLITFVPLA
SVWAVSGVAGLGAMLAFALVYGVAWRGGLSSDRLVLIGFGAWQGGMALITFLIVAHDPWN
TGKALTWMSGSTYGRTATQVLPVAIALLVLTPAVLAARRELDLMALDDDTPRVLGVRLER
TRLVALGAAALLTSTAVSAVGVIGFVGLVAPHAARALVGGRHARVLPVAALLGAALVSVA
DTLGRTVIAPAQIPAGLVTALIGTPYFVWLLWRSRASAPQSR
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagctgtccgcgcctccgcgttcggagccggccctcgggccggctccggccgga
cgcctgtccggtacccgcgtcgtcggggccttcatcgcggccaccgcgctggcgctcgtg
gtcgccgtcgtgcacctcacccagggcacctccgccgtgggcgcgctcgacctgctgcgg
ctgctcaccggcggcgacgacgaaaccgtacgggtgctcgtcgcctctcggatgccccgg
ttgctcgccgggctggccatcggcgtcgcgctcggcttcgccggtgcggccctgcagtcc
atcgcccgcaacccgctcgcctcgccggacaccctcgccgtcaacgccggtgcccacctg
gccatcgtctcggtcgccgcgttcggcatcgcgttgcccgcgttgcccgccggcgggctc
gccttctgtggcggtctcgcggcggcgggactggtgatggcgatgtcctccggcgggcag
gccggcaccacccggctgatcctcgccggctcggccaccgcactggcgctcagctcggtg
accatgctgctgctcctgctcttcgaacaggccaccatcggcctgttcgcctggggcaac
ggctcgctggtgcagagcgacctgaacgcgctcacccagctcgccccggtcatcggcctg
gccatcgtggcactgatgctgctcggccaccgcctcgacatcctcgccctcggcgacgac
accgccaccgtgctcggtctcgacgtgcggcgtacccggctgatcgtcacggtgctggcc
gttctgctctccgccgcggcggtcaccctcaccgggccggtcggattcgtcggcctctgc
gcgccggtgatcgtccggctgctcgggccactggtgcccggcgtacaccgccatcgggtg
ctgctgccgctctccggcatcgccggaatgatcatcgtgctcggctccgacgtgctgctt
cgggccgcgatgggtgcccaggccggtgtcgacattcccaccggcgtggtaaccaccctg
ctcggcgcggccatcctgatctggctggcccgacggcaccgcgacgccggccccacccgc
cgaccgccgggcggtcacgccgccgtccgctcggccggcttccaccgcaccgtcgtcatc
gtggtggccacggtcgccggcgtcgcggtggtggtcggcatgctggccggggacacctgg
gtgctcctcggtgacctggtcaactgggtcaacggcaacaccggtccggcgtacaccttc
gtgctggaccagcggtggccgcgcgtcgccgccgcgctgctggccggcgcggcgctcgcg
gtggccggcaccaccgtgcaggcggtctgccgcaacccccttgccgaacccggcatcctc
ggcatcaccgccggtgccggactgggcgcggtgtcgctgatcaccttcgtgccgctggcc
agcgtctgggccgtctccggggtggccgggctcggcgcgatgctcgccttcgccctggtc
tacggcgtggcctggcgaggcgggctcagctccgaccggctggtgctgatcgggttcggg
gcgtggcagggcggcatggcactgatcaccttcctgatcgtcgcccacgacccgtggaac
accggcaaggcgttgacctggatgtccggctccacctacggacgcaccgccacccaggtg
ctgccggtggcgatcgcgctgctggtcctcaccccggccgtgctcgccgcccgccgcgag
ctggacctgatggcgttggacgacgacaccccccgggtgctcggagtccggctggaacgt
acccgactggtcgcgctcggcgcggcggcgctgctcacctccaccgcggtctccgccgtc
ggcgtgatcgggttcgtcggtctggtcgccccgcacgccgcccgcgcgctggtcggcggc
cggcacgcccgggtgcttccggtcgccgcactgctgggcgcggccctggtcagcgtcgcc
gacaccctcgggcgcaccgtgatcgccccggcgcagatccccgccggtctggtcaccgcc
ctgatcggcaccccgtacttcgtctggctgctgtggcgctcgcgtgcctcagcccctcag
tcccggtaa

DBGET integrated database retrieval system