KEGG   Verrucosispora maris: VAB18032_13675Help
Entry
VAB18032_13675    CDS       T01471                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
vma  Verrucosispora maris
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    VAB18032_13675
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAB18032_13675
  Lipid metabolism
   00071 Fatty acid degradation
    VAB18032_13675
  Amino acid metabolism
   00350 Tyrosine metabolism
    VAB18032_13675
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VAB18032_13675
   00626 Naphthalene degradation
    VAB18032_13675
Enzymes [BR:vma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VAB18032_13675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1977664..1978710)
Genome map
AA seq 348 aa AA seqDB search
MRALRLPAWKSDPELVEVDEPTPGPGEVVVKIGGAGACHSDLHLMHDFEAGSLPWNPPFT
LGHENAGWVHALGAGVTGLEIGQPVAVYGPWGCGVCARCRVGAENYCENPAAAPIPGGGG
GLGLDGGMAEYELVPAARLVVPLPEGLDPVLAAPLTDAGLTPYHAIRRSWAKLPPGSTAV
VIGVGGLGHIGVQILKATTATRIIAVDTRDEALQLAEECGADQTLRSGERTVEEIRSATG
GRGADVVLDFVGADATMKMGAAAARTVGDLTIVGIGGGSLPVSFFSVPYEVSIQTTYWGS
RPELIEVLDLGARGLLRPKTTTFSLDDAMSAYRKMQDGTLEGRAVIVP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgctacggctgcctgcatggaagagcgacccggaactggtcgaggtcgacgag
ccgacacccggcccgggtgaggtggtggtgaagatcggcggcgccggcgcatgccactcc
gacctgcacctgatgcacgacttcgaagccggttccctgccctggaatccgccgttcacg
ctcggtcacgaaaacgccggctgggtgcacgccctcggcgccggtgtgaccggactggag
atcggccaaccggtcgccgtctacggcccctggggctgcggcgtctgcgcccgttgccgg
gtcggcgccgagaactactgcgagaacccggccgccgcacccatccccggtggcggcggc
ggtctcggcctggacggcgggatggccgagtacgagctggtgccggccgcccggctggtg
gtgccgctgcccgaggggctggacccggtgctggcggcgccgctgaccgacgcgggtctg
accccgtaccacgcgatccgccgctcctgggcgaagctgccgcccggcagcacggccgtg
gtgatcggtgtgggtgggctcggtcatatcggggtgcagatcctcaaggccaccaccgct
acccggatcatcgccgtggacacccgcgacgaggcgttgcaactggccgaggagtgcggc
gccgaccagacgctgcgctcgggtgagcggaccgtcgaggagatccgctcggccaccggc
gggcggggcgcggacgtcgtgctggacttcgtcggcgcggacgccaccatgaagatgggc
gctgccgccgcgcgtaccgtgggtgacctgaccatcgtcggcatcggcggcgggtcgctg
ccggtgagcttcttctccgtgccgtacgaggtcagcatccagaccacctactggggcagc
cgaccggagctgatcgaggtgctggacctgggcgcacgtgggctgcttcggccgaagacc
accacgttctccctggacgacgcgatgagcgcgtaccggaagatgcaggacggcaccctc
gaaggccgcgccgtgatcgtgccctga

DBGET integrated database retrieval system