KEGG   Verrucosispora maris: VAB18032_13675Help
Entry
VAB18032_13675    CDS       T01471                                 

Definition
(GenBank) alcohol dehydrogenase GroES domain-containing protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
vma  Verrucosispora maris
Pathway
vma00010  Glycolysis / Gluconeogenesis
vma00071  Fatty acid degradation
vma00350  Tyrosine metabolism
vma00625  Chloroalkane and chloroalkene degradation
vma00626  Naphthalene degradation
vma01100  Metabolic pathways
vma01110  Biosynthesis of secondary metabolites
vma01120  Microbial metabolism in diverse environments
vma01130  Biosynthesis of antibiotics
vma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAB18032_13675
  Lipid metabolism
   00071 Fatty acid degradation
    VAB18032_13675
  Amino acid metabolism
   00350 Tyrosine metabolism
    VAB18032_13675
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VAB18032_13675
   00626 Naphthalene degradation
    VAB18032_13675
Enzymes [BR:vma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VAB18032_13675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C MTS DapB_N
Motif
Other DBs
NCBI-ProteinID: AEB43847
UniProt: F4FH69
Position
complement(1977664..1978710)
Genome map
AA seq 348 aa AA seqDB search
MRALRLPAWKSDPELVEVDEPTPGPGEVVVKIGGAGACHSDLHLMHDFEAGSLPWNPPFT
LGHENAGWVHALGAGVTGLEIGQPVAVYGPWGCGVCARCRVGAENYCENPAAAPIPGGGG
GLGLDGGMAEYELVPAARLVVPLPEGLDPVLAAPLTDAGLTPYHAIRRSWAKLPPGSTAV
VIGVGGLGHIGVQILKATTATRIIAVDTRDEALQLAEECGADQTLRSGERTVEEIRSATG
GRGADVVLDFVGADATMKMGAAAARTVGDLTIVGIGGGSLPVSFFSVPYEVSIQTTYWGS
RPELIEVLDLGARGLLRPKTTTFSLDDAMSAYRKMQDGTLEGRAVIVP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgctacggctgcctgcatggaagagcgacccggaactggtcgaggtcgacgag
ccgacacccggcccgggtgaggtggtggtgaagatcggcggcgccggcgcatgccactcc
gacctgcacctgatgcacgacttcgaagccggttccctgccctggaatccgccgttcacg
ctcggtcacgaaaacgccggctgggtgcacgccctcggcgccggtgtgaccggactggag
atcggccaaccggtcgccgtctacggcccctggggctgcggcgtctgcgcccgttgccgg
gtcggcgccgagaactactgcgagaacccggccgccgcacccatccccggtggcggcggc
ggtctcggcctggacggcgggatggccgagtacgagctggtgccggccgcccggctggtg
gtgccgctgcccgaggggctggacccggtgctggcggcgccgctgaccgacgcgggtctg
accccgtaccacgcgatccgccgctcctgggcgaagctgccgcccggcagcacggccgtg
gtgatcggtgtgggtgggctcggtcatatcggggtgcagatcctcaaggccaccaccgct
acccggatcatcgccgtggacacccgcgacgaggcgttgcaactggccgaggagtgcggc
gccgaccagacgctgcgctcgggtgagcggaccgtcgaggagatccgctcggccaccggc
gggcggggcgcggacgtcgtgctggacttcgtcggcgcggacgccaccatgaagatgggc
gctgccgccgcgcgtaccgtgggtgacctgaccatcgtcggcatcggcggcgggtcgctg
ccggtgagcttcttctccgtgccgtacgaggtcagcatccagaccacctactggggcagc
cgaccggagctgatcgaggtgctggacctgggcgcacgtgggctgcttcggccgaagacc
accacgttctccctggacgacgcgatgagcgcgtaccggaagatgcaggacggcaccctc
gaaggccgcgccgtgatcgtgccctga

DBGET integrated database retrieval system