KEGG   Verrucosispora maris: VAB18032_13900Help
Entry
VAB18032_13900    CDS       T01471                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vma  Verrucosispora maris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VAB18032_13900
Enzymes [BR:vma01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     VAB18032_13900
Exosome [BR:vma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VAB18032_13900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2031007..2033109)
Genome map
AA seq 700 aa AA seqDB search
MDQLISGETHDPHAVLGAHPANGRTVIRTLRRGATEPCLLVGEQRYPMTRVHEVGVFEAT
VPGEVLDYRIEWNGQPHDDPYRHPPTLGELDLHLISEGRHERLWEALGARVLDGGVAFTV
WAPNARGVRVVGDFTGWAPDDGWPMRSLGSTGVWEIFVPGVQVGARYKYRILGADGHWRD
KADPLAGYAEVPPATASVVHRSTYEWGDADWLARRAKQQPHQEPMSVYEVHLGSWRPGLG
YRELAEQLAAYVTELGFTHVEFLPVMEHPFGGSWGYQVTGYYAPTSRFGDPDDFRYLVDR
LHAAGIGVILDWVPAHFPKDEWALARFDGTPLYEHPDPRRGEHPDWGTYVFDFGRREVRN
FLVANALYWLEEFHVDGLRVDAVASMLYLDYSRADGQWVPNQYGGRENLEAIAFMQETNA
TVYKHHPGVVMIAEESTAWPGVTRPTSDGGLGFGFKWNMGWMHDTLLYTSKDPIYRQHHH
HQLTFSLAYAWSENYVLPISHDEVVHGKGSLLGKMPGDQWQRLANVRVLLAYMWAHPGKQ
LLFMGCELADDREWSEERGLDWYLLHDPARAGVQRLVGDLNRVYRDTPALWAQDTSPAGF
RWLAGDDVANNTISFVRIAPDGATLVCVANFSALPLEDYRIGLPAAGAWAELLNTDAHHY
GGSGVGNLGTVHAEPVPWHGQPASVALRVPPLGALWLRPA
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggaccagctgatctccggggagacccacgacccgcacgccgtgctcggcgcccacccg
gcgaacggccgtacggtgatccgcaccctgcggcggggcgcgaccgaaccgtgcctgctg
gtgggtgagcagcggtacccgatgacccgggtgcacgaggtgggcgtcttcgaggcgacc
gtgcccggcgaggtgctcgactaccgcatcgagtggaacgggcagccgcacgacgacccg
taccggcatccaccgaccctgggcgagctggacctgcacctgatcagcgagggccggcac
gagcggctctgggaggccctcggcgcccgcgtcctcgacggcggggtggcgttcaccgtc
tgggcccccaacgcccggggcgtgcgggtggtcggcgacttcaccggctgggcgcccgac
gacggctggccgatgcgatcactgggctccaccggcgtgtgggagatcttcgtgcccggg
gtgcaggtgggggcccggtacaagtaccgcatcctcggcgccgacggtcactggcgggac
aaggccgaccccctggcggggtacgcggaggtgccgccggccaccgcctcggtggtgcac
cgctcgacgtacgagtggggcgacgcggactggctggcgcggcgggcgaagcagcagccg
catcaggagccgatgagcgtgtacgaggtgcacctcggctcgtggcggcccggcctgggc
taccgggaactggccgagcagttggccgcgtacgtgacggagctgggcttcacccacgtg
gagttcctgccggtgatggagcatccgttcggcggttcctggggctaccaggtcaccggc
tactacgccccgacgtcccgcttcggcgacccggacgacttccgttacctggtggaccgg
ctgcacgccgccggcatcggggtgatcctggactgggtgccggcgcacttccccaaggac
gagtgggccctggcccgcttcgacggcaccccgctctacgagcaccccgacccgcgtcgc
ggcgagcaccccgactggggcacgtacgtcttcgacttcggtcgccgcgaggtgcgcaac
tttctggtcgccaacgcgctctactggctggaggagttccacgtcgacgggctgcgggtc
gacgcggtcgcctcgatgctctacctggactactcgcgcgccgacgggcagtgggtgccc
aaccagtacggcggccgggagaacctggaggccatcgcgttcatgcaggaaaccaacgcg
acggtctacaagcaccaccccggggtggtgatgatcgccgaggagtccaccgcctggccg
ggagtgacccgaccgacaagcgacggcgggctcgggttcggcttcaagtggaacatgggc
tggatgcacgacaccctgctctacacctcgaaggacccgatctaccggcagcaccaccac
catcagctcaccttctccctggcgtacgcctggagcgagaactacgtgctgccgatcagc
cacgacgaggtggtgcacggcaagggctcactgctgggcaagatgcccggcgaccagtgg
caacgactggccaacgtccgcgtgctgctggcgtacatgtgggcgcacccgggcaagcaa
ctgttgttcatgggctgcgagctggccgacgaccgggagtggagcgaggagcgcggcctc
gactggtacctgctgcacgacccggcccgggccggcgtgcaacgcctggtcggcgacctc
aatcgggtctaccgggacacccccgcgctgtgggcgcaggacacctcccccgccggcttc
cgctggctcgccggagacgacgtcgccaacaacaccatctcgttcgtccggatcgccccc
gacggggcgaccctggtctgcgtggccaacttctccgccctgccgctggaggactaccgc
atcggcctaccagccgccggggcgtgggccgagctgctcaacaccgacgcccaccactac
ggcggttccggcgtcggcaacctcggcactgtccacgccgagcccgtcccctggcacggc
caacccgcctcggtggcgctgcgcgtccccccactcggcgccctctggctccgccccgcg
taa

DBGET integrated database retrieval system