KEGG   Verrucosispora maris: VAB18032_14255Help
Entry
VAB18032_14255    CDS       T01471                                 

Definition
cellobiohydrolase A (1 4-beta-cellobiosidase A)-like protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
vma  Verrucosispora maris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VAB18032_14255
Enzymes [BR:vma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     VAB18032_14255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2115440..2116813)
Genome map
AA seq 457 aa AA seqDB search
MRTRRTSAVVGAVTALTVAATVGVGALLAAPAAAADSAFYVDPQTSAARWVAANPGDSRA
AVIRDRIANVPQPRWYTTTNTSTVQGEVSQFVGAAAAAGKIPILVVYNIPNRDCSNHSGG
GAPNHSAYRQWVDQVAAGLQGRPATIILEPDVLPIMTSCMDGNQQAEVRASMAYAGKALK
RGSSAAKVYYDIGHGGWLSAGEAANRLLAADIANSADGISVNVSNYRSTAGEVSYAKSII
AATGISRLKAVIDTSRNGNGPAGSEWCDPPGRAIGTPSTTNTGDSAIDAFLWVKLPGEAD
GCIAAAGQFVPQRAYDLAIAAGPLPTTPAPTTPGPTTPPPPTTPPPPSTPPPGGAGCTVT
FTPNTWTGGFTAEIRVTNRGSSVNGWTLAFTAGSGVRLSNGWNGVWSQSGDRISVRNADW
NGSLPSGGTLSTGFQGTYSGSSLPAPSGFTLNGTNCT
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgagaacccgacgcacgtccgccgtggtcggcgcggtgacggcactcaccgtcgccgcc
accgtcggcgtgggcgcgctgctggcggcgcccgccgcggctgccgattccgccttctac
gtggacccgcagaccagcgccgcccgctgggtggcggccaacccgggcgactcccgggcc
gccgtgatccgggaccggatcgccaacgtgccgcagccccgctggtacaccaccaccaac
acctcgaccgtgcagggcgaggtgagccagttcgtcggcgccgccgcggcagcgggcaag
atcccgatcctggtggtctacaacatccccaaccgcgactgcagcaaccacagcggtggc
ggcgcgcccaaccacagcgcctaccgtcagtgggtggaccaggtggcggccggcctgcag
ggtcgaccggccaccatcatcctggagcccgacgtgctccccatcatgaccagctgcatg
gacggcaaccagcaggccgaggtccgggcctcgatggcgtacgccggtaaggccctcaag
cgcggctcgtcggcggcgaaggtctactacgacatcggccacggcggctggctctcggcc
ggcgaggccgccaaccggctgctcgccgcggacatcgccaacagcgccgacggcatctcg
gtgaacgtgtcgaactaccgcagcaccgccggtgaggtctcctacgccaagtcgatcatc
gcggcgaccgggatctcccgcctgaaggcggtcatcgacaccagccgtaacggcaacggt
cccgccggctcggagtggtgcgacccgccgggacgggcgatcggcacgccgagcaccacc
aacaccggcgactcggcgatcgacgccttcctctgggtcaagctgcccggcgaggccgac
ggctgcatcgccgccgccggtcagttcgtgccgcagcgggcgtacgacctggccatcgcg
gccgggccgctgcccaccacgccggcccccaccaccccggggcccaccactcccccgccg
cccaccactcctccgccgcccagcaccccgccgcccggtggcgccggttgcacggtgacg
ttcaccccgaacacctggaccggtggcttcaccgccgagatccgggtgaccaaccgcggc
agctcggtgaacggctggaccctggccttcacggccggctccggggtacggctgagcaac
ggctggaacggcgtctggagccagtccggcgaccggatctcggtccgtaacgccgactgg
aacggcagcctgcccagcggtggcaccctcagcaccggcttccagggcacctacagcggc
agcagcctgccggcaccgagcggtttcaccctcaacggcaccaactgcacctga

DBGET integrated database retrieval system