KEGG   Verrucosispora maris: VAB18032_14405Help
Entry
VAB18032_14405    CDS       T01471                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
vma  Verrucosispora maris
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vma00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:vma00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2144509..2146020
Genome map
AA seq 503 aa AA seqDB search
MSASNGNLAALATAVLQPGFVGTVPPDWVRRWLGDGLGSVVLFSRNVVDPEQVSALTAAL
RAERPDVIVAIDEEAGDVTRIESVRGSSRPGNLALGIVDDPALTEEVARDLGAELAAAGV
TLNYAPDADVNSNPDNPVIGVRSFGADAALVARHTTAWVRGLQSSGVAACAKHFPGHGDT
HVDSHHDLPRITADRARLDAVELAPFRAAVAAGVQAVMTGHLLVPALDPHLPATLSSRIL
GGLLREELGFSGVVVTDGIEMQAVAGRYGLAGAVVRALAAGADAICVGGEHADEQTVRHL
RDAIVAAVVTGDLPEERLAEAAKRVGQLAAWTVAARAAGPVGDPADGTGSAVGLHAARRA
VRITRTGGEAALPLGRAAHVVEFAPPHNIAIGADTPWGVAAPLAELLPGTTVARYTEAAT
PADPGADAAGRPLVLVVRDLHRHTWMRAAVDRALIARPDAVVVELGVPALVTGPVHIATH
GATRAAGRAAAEVLSGVTVTSSW
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgtccaacggaaacctggcggcgttggcgacggccgttctccagccgggtttc
gtcggcaccgtcccacccgactgggtccgccgctggctcggcgacgggctcgggtcggtg
gtcctgttcagccgcaacgtcgtcgacccggagcaggtcagcgcgctgaccgccgcgctg
cgggcggaacggccggacgtgatcgtcgcgatcgacgaggaggccggcgacgtcacccgg
atcgagtcggtgcggggcagttcccggccgggcaacctcgccctcggcatcgtggacgac
ccggcgctcaccgaggaggtcgcccgcgacctcggggccgaactcgccgccgccggagtg
accctgaactacgcgccggacgccgacgtcaattccaacccggacaatccggtgatcggg
gtccgttccttcggcgccgacgccgcgctggtggcccggcacaccaccgcctgggtacgc
ggcctgcagtccagtggtgtcgccgcctgcgccaagcacttccccggccacggcgacacc
cacgtcgactcgcaccacgacctgccccgcatcaccgccgaccgggcccggctggacgcc
gtcgagctggcccccttccgggccgctgtcgccgccggcgtgcaggcggtgatgaccggc
catctgctggtgcccgcgttggacccgcacctgccggccaccttgagcagccggatcctc
ggtggcctgctgcgggaggagttgggcttcagcggggtggtggtgaccgacgggatcgag
atgcaggccgtggcgggccggtacggcctcgccggcgccgtcgtacgggccctcgccgcc
ggtgcggacgcgatctgcgtgggcggtgagcacgccgacgagcagaccgtccgtcacctg
cgggacgccatcgtggccgcggtcgtcaccggggacctgccggaggagcggctggccgaa
gcggccaaacgggtcggtcagctcgccgcctggacggtggccgcccgggcggccgggccg
gtcggcgatccggccgacggcaccggttcggcggtcggtctgcacgcggcccgtcgcgcc
gtccggatcacccggaccggcggggaggccgcgctgccgctgggccgcgccgcgcacgtg
gtggagttcgcgccaccgcacaacatcgccatcggcgcggacaccccgtggggcgtggcc
gcaccgctggccgaactgctgccgggcaccaccgtcgcccgctacaccgaggcggcgacg
ccggccgacccgggcgccgacgccgccggccgtcccctggtcctggtggtgcgggacctg
caccggcacacctggatgcgcgccgccgtcgaccgggcgctgatcgcccgccccgacgcg
gtggtggtggagctgggagtccccgcgctggtcaccggtccggtgcacatcgccacccac
ggcgccacccgggccgcgggacgggccgcggccgaggtcctcagcggggtcacggtcacg
tcaagctggtga

DBGET integrated database retrieval system