KEGG   Verrucosispora maris: VAB18032_14700Help
Entry
VAB18032_14700    CDS       T01471                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
vma  Verrucosispora maris
Pathway
vma00072  Synthesis and degradation of ketone bodies
vma00650  Butanoate metabolism
vma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    VAB18032_14700
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    VAB18032_14700
Enzymes [BR:vma01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     VAB18032_14700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase NAD_binding_10 KR F420_oxidored Methyltransf_11 Methyltransf_25 TrkA_N Sacchrp_dh_NADP 3HCDH_N ApbA NAD_binding_2 2-Hacid_dh_C Shikimate_DH AdoHcyase_NAD THF_DHG_CYH_C 3Beta_HSD FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEB44052
UniProt: F4F2I0
Position
complement(2202319..2203068)
Genome map
AA seq 249 aa AA seqDB search
MNVDLTGRIAVVTGGGSGIGRACALRLAVAGAQVLVVDRNAEAAEQVAAEAGGRAVGVDL
ADAAAVDRLDAGVDIVVNNAGLQHVAPIQDFPVERFEYLQRVMVEAPFLLIRRALPHMYA
QGWGRVVNISSVHGLRASPYKAAYVAAKHALEGLSKVVALEGAAHGVTANCINPAYVRTA
LVEDQIADQAATHGIPETEVIEKIMLARAAIKRLIEPDEVAELLAYLCSPPAAFLTGASI
ALDGGWTAN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtcgacctcaccggccgcattgctgtggtgaccggcggcggcagcggcatcggt
cgggcctgcgccctacggctggccgtggccggcgcccaggtgctggtggtcgaccgcaac
gccgaggcggccgagcaggtggcggcggaggccggtggccgggctgtgggggtggatctg
gcggacgccgccgcggtagaccggctcgacgccggcgtggacatcgtggtcaacaacgcc
ggtctgcagcacgtcgccccgatccaggacttcccggtcgaacgcttcgagtacctgcag
cgggtgatggtcgaggcgccgttcctgctgatccggcgggcgctgccgcacatgtacgcg
cagggctggggccgggtcgtcaacatctcctcggtgcacgggctgcgcgcctcgccctac
aaggcggcgtacgtcgcggcgaaacacgccctggaagggctgtccaaggtggtggcgctg
gagggcgcggcgcacggcgtcaccgccaactgcatcaaccccgcgtacgtgcgcaccgcc
ctggtggaggaccagatcgccgaccaggccgccacccacggcatcccggagaccgaggtg
atcgagaagatcatgctggcccgggccgcgatcaagcgcctgatcgagccggacgaggtg
gcggaactgctggcctacctctgctcaccgccggcggcgttcctcaccggcgcgtcgatc
gcgctcgacgggggctggacggcgaactag

DBGET integrated database retrieval system