KEGG   Verrucosispora maris: VAB18032_16505Help
Entry
VAB18032_16505    CDS       T01471                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vma  Verrucosispora maris
Brite
Enzymes [BR:vma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     VAB18032_16505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2620268..2621350)
Genome map
AA seq 360 aa AA seqDB search
MTELDRAFDAVPAPIYTHHERHGETVHRSAPESIRRELAALQVRAGDRVLEIGTGSGYSG
ALLAHLCCPDGQVTSIDISDELVRRAAAIHAERGVTSVDCHVGDGLAGYPAAAPFHRAVS
WCAPPRLPRAWTQQVVNGGRIVACLPITALPSTTLIATITVAAGKPRIEALAGGGYAQST
PVAVDDALTVPGRWVDYCDRQPDPSWIGICWRSADDAQHTGARSALGQLLHPGYTDTYRQ
MEPHWRSWYTWTSALGDPQLSLVSLRNEIRGLGHTTPSSAAVILTDGRVIADRPDSPSLR
SLRTWLQRWEHVGRPAPESFARTLVPHDCPDLAGWDLQVGHGSVTTDRQPPRRVDEPRRP
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagctcgaccgggccttcgacgccgtaccggccccgatctacacccaccatgaa
cggcacggcgaaacggtgcaccgctcggcaccggagtcgatccgccgcgagctggccgcc
ctgcaggtccgcgccggggaccgggtgctcgagatcggtacgggctccgggtacagcggc
gcgctgctcgcgcacctgtgctgcccggacggccaggtcaccagcatcgacatcagcgac
gaactcgtccgccgcgcggcagccatccacgccgagcgcggggtaaccagcgtcgactgc
catgttggcgacggactggccggctacccggccgcagcgcccttccatcgagctgtttcg
tggtgtgctccgccgcggctgccgagggcgtggacgcagcaggtcgtgaacggtgggcgg
atcgtcgcgtgcctgccgatcacggccctgccgtcgaccacgttgatcgccaccatcacc
gttgcggccgggaaacctcgtatcgaagccctcgccggaggcggctacgcccagagcacg
cccgtcgcggtcgacgatgccctgaccgtccccggccgctgggtcgactactgcgaccgc
cagcccgatccgtcctggatcggcatctgctggcgttctgccgacgacgcccagcacacc
ggcgctcgctccgccctcggccagctgctgcatcccgggtacaccgacacgtatcggcag
atggagccgcactggcgctcctggtacacctggacgtccgcgctcggcgacccgcagctg
agcctggtgtcgctgcgcaacgagatccgcggactcggtcacaccacaccaagttcggcg
gcggtgatcctgaccgatggcagggtcatcgcggaccggccggactcgccgtccctgcgc
tccttgcggacctggctgcaacggtgggaacacgtcggccgtccggcacccgagtccttc
gcccgcaccctggtgccgcacgactgccctgatctcgccggctgggacctgcaggtcggc
catggctccgtgaccaccgaccggcagccgccgcggcgcgtcgatgagcctcgccgccct
tga

DBGET integrated database retrieval system