KEGG   Verrucosispora maris: VAB18032_17130Help
Entry
VAB18032_17130    CDS       T01471                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vma  Verrucosispora maris
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vma01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:vma00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:vma00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2761975..2763117
Genome map
AA seq 380 aa AA seqDB search
MSDNMAQLTDRSGRRYASDQPRWRGDDKSPLMMEPLPGITREQIDTGVNSQWRYRAALPL
PQADPVTLGEGRTPLLPRTFAGLHVAVKPESMNPTGSFKDRGSSVMITALRHQGIGQILE
DSSGNGGSSIAAYSAAAGIDAQIIAPASTSPTKIAQVRLHGAGVDLVPGSRQDVADEAIR
RADTRFYASHNWHPHFLQGIKLIAYEIWEDLGFTAPSAVLVPAGAGSLVLGCAMGFAELR
RAGEIDQVPRILVSQPEHCCPLVNALTGGDIAVEARTWPKTLAEGAAIAQPVRDREVLAA
IRDSGGAATAVAEEELLPAVRELARTGVFVEPTSAQVLPALRQFHADGHINPDDTVVLVL
TGSGLKAGQALSDFVNDVSP
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaacatggcccagctcaccgaccgcagcggccgccgctacgcatccgaccag
ccccgctggcgtggcgacgacaaatccccgctgatgatggagcccctgcccggcatcacc
cgcgagcagatcgacaccggcgtcaactctcagtggcgctatcgggccgcgctgcccctg
ccccaggccgatcccgtcaccctgggcgaaggacgcacccccctgctgccgcggaccttc
gcgggactccacgtggccgtcaagcccgagtccatgaaccccaccggcagtttcaaggac
cgcggcagctccgtcatgatcactgcgctgcgccaccagggcatcgggcagatcctcgaa
gactccagcggcaacggcggctcctccatcgccgcctacagcgccgccgccggcatcgac
gcccagatcatcgcccccgcctccacgtctcccacaaagatcgcgcaagtacgcctgcac
ggagcgggcgtggatctcgtccccggcagccgccaggacgtcgccgacgaagccatccgc
cgcgccgacacccgcttctacgccagccacaactggcacccccacttcctccagggcatc
aagctgatcgcctacgagatctgggaggacctgggcttcaccgccccctcggccgtcctg
gtgccggccggcgccggcagcctcgtcctgggctgcgccatgggtttcgccgagctcagg
cgggcaggagagatcgaccaggtgccccgcatcctggtcagccagcccgaacactgctgc
ccgctggtcaacgccctcacgggcggcgacatcgcggtcgaggcccgcacctggcccaag
acactcgccgaaggagccgccatcgcccagccggtacgcgaccgggaggtcctcgcggcg
atccgtgacagcggcggcgccgccaccgcagtcgccgaggaggaactcctacccgccgtg
cgtgagctcgcccgtaccggcgtgttcgtggaacccaccagcgcgcaggtcctgcccgcc
ctccgccagttccacgccgacggccacatcaaccccgacgacaccgtggtcctcgtcctg
accggctccggcctcaaggccggccaggcgctcagtgatttcgtcaacgacgtctccccg
tga

DBGET integrated database retrieval system