KEGG   Verrucosispora maris: VAB18032_17790Help
Entry
VAB18032_17790    CDS       T01471                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
vma  Verrucosispora maris
Pathway
vma00360  Phenylalanine metabolism
vma00362  Benzoate degradation
vma00620  Pyruvate metabolism
vma00621  Dioxin degradation
vma00622  Xylene degradation
vma00650  Butanoate metabolism
vma01100  Metabolic pathways
vma01120  Microbial metabolism in diverse environments
vma01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VAB18032_17790
   00650 Butanoate metabolism
    VAB18032_17790
  Amino acid metabolism
   00360 Phenylalanine metabolism
    VAB18032_17790
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VAB18032_17790
   00622 Xylene degradation
    VAB18032_17790
   00621 Dioxin degradation
    VAB18032_17790
Enzymes [BR:vma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     VAB18032_17790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AEB44660
UniProt: F4FAP5
Position
complement(2904561..2905472)
Genome map
AA seq 303 aa AA seqDB search
MSTGVAVIGSGNIGTDLMIKVLRLSESLRMVAMVGIDPDSDGLARARRLGVATTAAGVDG
LVAMPEFADVGIVFDATSAGAHRHNDAVLRAHGRRVVDLTPAAIGPYVVPPVNLDAHLGE
RNVNMVTCGGQATVPIVAAVRRVTPVAYGEIVASISSRSAGPGTRANIDEFTETTARAIE
VVGGAGRGKAVIVLNPAEPPLLMRDTVYCLCPDPDADRDAIAASVEAMVAAVQQYVPGYR
LKQQVQFTEVDTYVPALGGHFVGIQVSVFLEVSGAGHYLPAYAGNLDIMTSAALRTAERM
VSS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggcgtggcggtgatcggttccggcaacatcggcaccgacctgatgatcaag
gtgttgcggctgtcggagtcgctgcggatggtggcgatggtcggcatcgacccggactcc
gacggtctggcccgggcccgtcggctcggtgtggccaccaccgccgcaggtgtcgacggg
ctcgtcgcgatgccggagttcgccgacgtcgggatcgtcttcgacgccacaagcgcgggc
gcgcaccggcacaacgacgcggtgctgcgcgcccacggccgccgggtcgtcgacctgacc
ccggccgccatcggcccgtacgtggtgccgccggtgaacctcgacgcccacctgggcgag
cgcaacgtcaacatggtcacctgcggcgggcaggcgaccgtgccgatcgtcgccgcggta
cgccgggtcacgccggtggcgtacggcgagatcgtcgcctcgatctcctcccgttcggcc
ggtccgggcacccgcgccaacatcgacgagttcaccgagaccaccgcccgggccatcgag
gtggtcggcggggcgggccgcggcaaggcggtgatcgtgctgaatccggcggagccaccg
ctgctgatgcgcgacacggtctactgcctgtgccccgatccggacgccgaccgcgacgcg
atcgcggcgtcggtggaggcgatggtggcggcggtgcagcagtacgtgcccggctaccgg
ctcaagcagcaggtgcagttcaccgaggtggacacgtacgtgccggcgctcggcgggcac
ttcgtcggcattcaggtctccgtgttcctggaggtctccggtgccggccactacctgccc
gcgtacgcgggcaacctggacatcatgacaagcgccgcgctgcgtacggccgaacggatg
gtctcgtcgtga

DBGET integrated database retrieval system