KEGG   Verrucosispora maris: VAB18032_19185Help
Entry
VAB18032_19185    CDS       T01471                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vma  Verrucosispora maris
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VAB18032_19185
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VAB18032_19185
   00630 Glyoxylate and dicarboxylate metabolism
    VAB18032_19185
Enzymes [BR:vma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VAB18032_19185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3263746..3265356
Genome map
AA seq 536 aa AA seqDB search
MRYEVIGPMAERFDEVLTPEALEFLVTLDSEFAARRVALLDTRRARRDRFATGQLPDFLP
ETIGVRADPTWRVAPPAPGLEDRRVEITGPPERKMTINALNSGAKVWLADFEDATAPTWD
NVIGGQLNLMDALDRRIDFTDPRGKRYALGEELATIVVRPRGWHLVEKGIVVDGRPISAS
LVDFGLYLFHCARRQLAAGAGPYFYLPKLEDHREARLWNDIFVFAQHYLKLPQGTIRATT
LIETITAAFEMEEILYELREHSAGLNAGRWDYIFSIIKNFGQWPDFVLPDRAAVTMTVPF
MRAYTELLVRTCHRRGAHAIGGMAAFVPSRDPEVNENALAKVRADKQREAGDGFDGSWVA
HPGLVPTCREVFDAVLGERPHQLDRQRDEVSVTAADLLSVDKTPGQVTESGLRSNIAVAL
HYIDAWLGGAGAVALWNLMEDAATAEIARCQVWQWLHHGTPLAEGGSVTSDRVRALLAEE
LSALSEGRGDAERERAAQAARIVEETALGEDLPAFFTTGAYARHLGPRRRSLAAAS
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacgaggtcatcggcccgatggccgaacgcttcgacgaggtgctcacgcccgag
gcgctggagttcctggtcaccctggacagcgagttcgccgcccggcgggtcgccctgctg
gacacccgccgggcgcgccgcgaccggttcgccaccggccagctgcccgacttcctgccg
gagaccatcggcgtgcgggccgacccgacctggcgggtggccccaccggcaccagggctg
gaagaccggcgcgtcgagatcaccggcccaccggaacgcaagatgaccatcaacgcgctg
aactccggcgccaaggtgtggctcgccgacttcgaggacgccaccgcccccacctgggac
aacgtcatcggtggacaactcaacctgatggacgccctggaccggcggatcgacttcacc
gacccgcgcggcaagcggtacgccctcggcgaggaactggccaccatcgtggtccggccg
cgcggctggcacctggtggagaagggcatcgtggtggacgggcggccgatttcggccagc
cttgtcgacttcgggctctacctgttccactgcgcccgtcggcaactcgccgccggcgcc
ggaccgtacttctacctgccgaagctggaggaccaccgcgaggcccggctgtggaacgac
atcttcgtcttcgcccagcactacctgaagctgccgcagggcaccatccgggcgaccacg
ctgatcgagacgatcacggcggccttcgagatggaggagatcctctacgagctgcgcgaa
cactcggccgggttgaacgccggccggtgggactacatcttcagcatcatcaagaacttc
gggcagtggccggacttcgtcctgccggaccgggccgcggtcaccatgacggtgccgttc
atgcgggcgtacaccgagttgctggtgcggacctgtcaccgacgtggcgcgcacgcgatc
ggcgggatggccgccttcgtgcccagccgggatccggaggtcaacgagaacgccctggcc
aaggtgcgggcggacaagcagcgggaggccggcgacgggttcgacggctcctgggtggcc
caccccggcctggtgccgacctgccgggaggtgttcgacgcggtgctcggcgagcgcccg
caccagctcgaccggcagcgggacgaggtgtccgtgaccgccgccgacctgctctcggtg
gacaagaccccgggccaggtcaccgagtcgggcctgcggtccaacatcgcggtggcgttg
cactacatcgacgcctggctcgggggagcgggcgcggtggcgctgtggaacctgatggag
gacgccgcgaccgccgagatcgcccgctgccaggtgtggcagtggctgcaccacggtacg
ccgttggccgagggcggcagcgtcacctcagaccgggtgcgagcgctgctcgccgaggag
ctgtcggcgctgtccgaggggcgcggcgacgccgagcgggaacgcgccgcgcaggcggcg
cgcatcgtcgaggagaccgcgttgggcgaggacctgccggccttcttcaccaccggcgcg
tacgcccggcacctggggccgcgccgccggtcactcgcggcggccagctga

DBGET integrated database retrieval system