KEGG   Verrucosispora maris: VAB18032_19255Help
Entry
VAB18032_19255    CDS       T01471                                 

Definition
putative arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
vma  Verrucosispora maris
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vma01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:vma00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3276695..3277582
Genome map
AA seq 295 aa AA seqDB search
MRSITVLDAPSNLGLRAPAPGLVPGCYKLAGALRDQRLLDRLGAHDGGVVVPPRYDIRGW
RPGDGVLNADALATYTRRLAERVNVVLDNAGFLMLLGGDCSILFGAALALRRRGRYGIAY
LDGSIDFRHTGNSTYVGASAGEGTAIVTGRGQPDIADIDGLAPYCREDDLVVLGVRDYDD
HLHEVRGLGITVHTAPEIIAEGPVLVGDRVAQGLAGCDGYFVHLDADVLDPAVMPAADAP
DPGGLDHPHLVELLRPLLANPACVGLEVTIYDPDLDPDGRYAAALVDTLVDALRS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgatcgatcacggttcttgacgccccgtccaatctcgggttgcgtgccccggcccct
ggtctcgtccccgggtgttacaagctggccggtgcgcttcgcgatcagcgtctgctcgac
cggctcggggcgcacgacggtggcgtggtcgtcccgccgcgctacgacatccgtggctgg
cggccgggggacggtgtactcaacgccgacgccctcgcgacgtacacgcgccgactcgcg
gagcgggtgaacgtggtcctcgacaacgcgggcttcctgatgctgttgggcggtgactgt
tcgatccttttcggggccgcgctcgcgctacgccgacgtggccgctacggcatcgcctac
cttgacggttcgattgacttccgtcataccggcaacagcacgtatgtgggggcgtccgca
ggcgagggtaccgccatcgtcaccggccggggtcagccggacattgccgacatcgacggg
cttgcgccgtactgccgtgaggacgatctggttgtcctgggcgtccgcgactacgacgac
catctccacgaggtgcgtggtctgggcatcacggtgcataccgcgcccgagatcatcgcc
gagggccctgtcctggtcggcgatcgtgtggcacagggacttgccggctgcgacggctac
ttcgtacacctcgacgccgatgtgctcgaccctgcggtgatgccggccgccgacgcgccc
gaccccggcggcttggaccatccgcatctggtggaactgctccgtccgctgctcgcgaac
ccagcctgtgtcggccttgaggtgacgatctacgacccggacctcgacccggacggccgc
tacgccgccgcgctcgtcgacaccctggtcgacgccctgcgaagctga

DBGET integrated database retrieval system