KEGG   Verrucosispora maris: VAB18032_19530Help
Entry
VAB18032_19530    CDS       T01471                                 

Definition
ricin B lectin
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
vma  Verrucosispora maris
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VAB18032_19530
  Lipid metabolism
   00561 Glycerolipid metabolism
    VAB18032_19530
   00600 Sphingolipid metabolism
    VAB18032_19530
Enzymes [BR:vma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     VAB18032_19530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3335674..3337326)
Genome map
AA seq 550 aa AA seqDB search
MRARPRWLAVLSVLVLTLTTVVVDGLHSPKPAQALNNGVARTPPMGWNTWNTFGCNINET
LIRQMADAIVNTGMRDLGYKYVVVDDCWFDPNRDAQGNLQAHAGRFPSGMKALGDYLHSR
GLLFGLYQVPREKTCAQYFGAWPGSTGSLGHEYQDARQFAAWGVDFLKYDWCSPWGTIND
QIAGFSLMRDALAATGRPIVYSINPNSIHEKTGPQRNWGDIANMWRTTEDITNAWNTGQT
NGYPMGIQNIVNVNVPIASYASPGSFNDPDMLVVGNGGMTDTEMRSHFALWAIMAAPLIA
GNDIRNASAATLDILRNQNLVAINQDSLALQAVQVANDGIRRVLAKRLANGDVAVALFNQ
GNSTTTVSTTAAAIGKSGNSFTLRDAWTNTTSTSTGTISASVPAHGTVVYRVSGGGTTTP
PPPPTTFRLRSESSGRCLDVNNSGTANGTATLIWDCHTASNQSFTQNGQALQVLGKCLDI
SPTATPGTPVQIWDCNGGTNQQWTFNSNGTISNVRSPNLCLDVNNNGTANGTPVIVWTCH
TAPNQRWTRT
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcacgaccacgatggttggccgtcctgagcgtcctggtgctgacgctcaccacg
gtcgtcgtcgacggactccactcaccgaaacccgcacaggcgctgaacaacggcgtggct
cgcaccccaccgatggggtggaacacctggaacaccttcggctgcaacatcaacgagacg
ctgatccggcagatggccgatgcgatcgtcaacaccggcatgcgcgacctcggctacaag
tacgtcgtcgtcgacgactgctggttcgacccgaaccgcgacgcgcagggcaaccttcag
gcccatgccggccgcttccccagcggcatgaaggccctcggcgactacctgcactcccgg
ggtctgctcttcggcctctaccaggtgccccgggagaagacctgcgcccagtacttcggc
gcctggcccggttccaccggtagcctcgggcacgaataccaggacgcccggcagttcgcc
gcctggggcgtggacttcctcaagtacgactggtgctcaccgtggggcaccatcaacgac
cagatcgccgggttctcgctgatgcgcgacgccctcgcggccaccggtcggcccatcgtc
tacagcatcaacccgaacagcatccacgagaagaccggcccccagcgcaactggggcgac
atcgccaacatgtggcggaccaccgaggacatcaccaacgcgtggaacaccggtcagacc
aacggctacccgatgggcatccagaacatcgtcaacgtcaacgtgcccatcgcctcgtac
gcctcaccgggctcgttcaacgacccggacatgctcgtggtcggcaacggcggcatgacc
gacaccgagatgcgcagccacttcgccctctgggcgatcatggcggcaccgctgatcgcc
ggcaacgacatccgtaacgccagcgccgccacgctggacatcctgcgcaaccagaacctc
gtcgccatcaaccaggattccctggcgctgcaggcagtgcaggtcgccaacgacggcatc
cgccgggtgctggccaagcggctggccaacggcgacgtcgcggtcgccctgttcaaccag
ggcaactccaccaccaccgtctccaccacggcggcggcgatcggcaagtccggcaactcg
ttcaccctgcgcgacgcctggaccaacaccacctcgacgagcaccggaacgatctcggca
agcgtcccggcgcacggcaccgtggtctaccgggtcagcggtggcggcaccaccactccc
ccgcccccgccgaccaccttccggctgcgcagcgaatcgtccggccgctgcctggacgtc
aacaacagcggtaccgccaacggcaccgcgacgctgatctgggactgccacaccgccagc
aaccagagcttcacccagaacggtcaggccctgcaggtgctcggcaagtgtctggacatc
tccccgaccgccacccccggcactcccgtacagatctgggactgcaacggcggcacgaac
caacagtggacgttcaacagcaacggcaccatcagcaacgtccgctcccccaacctctgc
ctggacgtcaacaacaacggcaccgccaacggcacccccgtgatcgtctggacctgccac
accgcccccaaccaacgctggacccgcacctaa

DBGET integrated database retrieval system