KEGG   Verrucosispora maris: VAB18032_20450Help
Entry
VAB18032_20450    CDS       T01471                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
vma  Verrucosispora maris
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VAB18032_20450
Enzymes [BR:vma01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     VAB18032_20450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3534651..3536657
Genome map
AA seq 668 aa AA seqDB search
MGGMFNDGRLCFGGDYNPEQWPASVWAEDVALMRRAGVNLVTVGVFAWSRLEPAPGRYTF
DWLDEVLDLLHAGGIRVALATPTASPPPWFSAAHPGALPVTADGVRLHHGSRDTYCAAAP
AYRTAARGIAGALADRYAHHPALALWRVHNEYGTICHCEHTARAFRRWLADRHGDLAALN
DAWVTSFWSQHYSDWTQISTPRATQYLANPGQLLDFRRFWSDTLLAAYREQRDLLRAANP
SIPVTTNYVLGDWVPVDHARWAGEVDVVAVDHYPSAVDIGAEEQTALVGDLARGWARHGS
RHHGDPTSTWLLMESAPQQIHTTGRAHTKEPGRMIRHSLAHVARGSQGAMFFQWRAPTGG
AERFHSALVPHAGPDSRVFREATDLGTALHRLAEVDGQVEAGVALAVDAASGWALRHPGM
PSDRLDHQQETAAAHRALWHAGYGCDIVLPGDPLTGYRLLVLPALYLTDDDTAQWVGEYV
TGGGHLLATYLSGVADEHARVRLGGYPGALRDLLGVRVEEFHPLAADDQVRLSDGGTGRI
WAETLRPTGAQVITAYAGGVLDGQPAITRHRAGSGTAWYVSTRPDDATYRRLLDEAARSA
GLTPVCPDAPAGVEAVRRRAAHGSWLFLFNHTDTPQRVPARGTDLLTATAVDEAVQLPPG
GVAVLREH
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
gtgggtggcatgttcaacgacggccgactctgcttcggcggggactacaacccggaacag
tggccggcgtcggtgtgggccgaggacgtcgcgttgatgcgccgggccggggtcaacctg
gtcaccgtcggcgtgttcgcctggtcccgcctggaaccggcccccggccggtacaccttc
gactggctcgacgaggtgctcgacctgctgcacgccggcggcatccgcgtcgccctggcc
accccgacggcctccccgccgccgtggttctccgcggcccacccgggcgccctgccggtc
accgccgacggcgtacgcctgcaccacggcagccgggacacctactgcgccgccgcgccc
gcctaccgtacggccgcgcggggcatcgccggcgccctcgccgaccggtacgcccaccac
ccggccctggcgctgtggcgcgtgcacaacgagtacggcaccatctgccactgcgaacac
accgcccgcgcgttccgccgctggctggccgaccggcacggcgacctcgccgccctcaac
gacgcctgggtcaccagcttctggagccagcactacagcgactggacgcagatcagcacc
ccccgcgccacccagtacctggccaaccccggccagctgctcgacttccgtcgcttctgg
tcggacaccctgctggccgcgtaccgcgaacaacgcgacctgctgcgcgccgccaacccg
agcatcccggtcaccaccaactacgtgctcggcgactgggtgccggtcgaccacgcccgc
tgggccggcgaggtggacgtggtcgccgtcgaccactacccgtcggcggtcgacatcggc
gccgaggaacagaccgccctggtcggtgacctggcccgaggctgggcccggcacggcagc
cgccaccacggcgacccgacgtcgacctggctgctgatggaaagcgccccccagcagatc
cacaccaccggtcgggcgcacaccaaggaacccggccgcatgatccgacacagcctcgcc
cacgtcgcccgcggctcgcagggggcgatgttcttccagtggcgggcccccaccggcggc
gccgaacgattccactcggcgctggtgccacacgccggcccggacagccgggtcttccgc
gaggcgaccgacctcggcaccgccctgcaccgactcgccgaggtcgacgggcaggtcgag
gccggtgtggcgttggcggtggacgcggcgagcgggtgggcgctgcgccacccgggtatg
ccctcggaccggctcgatcaccagcaggagaccgccgccgcccatcgcgccctctggcac
gccggctacggctgcgacatcgtgctgcccggtgacccgctcaccgggtaccggctgctc
gtcctgcccgccctctacctgaccgacgacgacaccgcccagtgggtcggcgagtacgtc
accggcgggggacacctgctggccacgtacctcagcggggtcgccgacgaacacgcccgg
gtgcgactcggcggctacccgggcgcgctacgcgacctgctcggcgtgcgggtcgaggag
ttccatccgctcgccgccgacgaccaggtgcggctgagcgacggcgggaccgggcggatc
tgggccgagacgctacggcccaccggcgcgcaggtgatcaccgcgtacgccggtggggtc
ctcgacggccagccggcgatcacccggcaccgggccggctccgggaccgcctggtacgtc
tccacccgacccgacgacgccacctatcgccgcctgctcgacgaggcggcccggtcggcc
ggcctcaccccggtgtgcccggacgcaccggccggcgtcgaggcggtccgccgccgtgct
gcgcatggcagttggctgttcctgttcaaccacaccgacaccccgcaacgggttccggcc
cgcggcaccgacctgctcaccgcgaccgcggtcgacgaggcggtgcagttgccgcccggc
ggcgtcgccgtgctgcgcgaacactga

DBGET integrated database retrieval system