KEGG   Verrucosispora maris: VAB18032_24635Help
Entry
VAB18032_24635    CDS       T01471                                 

Definition
(GenBank) alcohol dehydrogenase GroES domain-containing protein
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
vma  Verrucosispora maris
Pathway
vma00625  Chloroalkane and chloroalkene degradation
vma00680  Methane metabolism
vma01100  Metabolic pathways
vma01120  Microbial metabolism in diverse environments
vma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    VAB18032_24635
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VAB18032_24635
Enzymes [BR:vma01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     VAB18032_24635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C Pyr_redox_2 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AEB46025
UniProt: F4FC27
Position
complement(4466825..4467973)
Genome map
AA seq 382 aa AA seqDB search
MRSVDVCEVPDPEVQEETDAVVRITSTALCGTDLHMYDGRTGAQPGLVLGHEPLGVVERV
GSAVQTVRPGTRVVIPTHLFCGVCAMCARGLSALCLRARPDGLGAAYGYVGMGPYPGAQA
ELLRVPWADANCLPLPGEPGDAYEDDFVLLADAFVTGWHAAATLADVRAGDTVAVFGAGT
IGLLAAYAAGLLGARTVYSVDHVDARLGKAEELGAVPMDFRQGDPVEQIRADRARRGLPL
GEEKLPGVDKVIDAVGFQAHDRAHPDRERADQVLADAARLVNPGGAVAVAGVYPESDSTP
QAGGSADGHLDAPWGTFFAKAVALRFGRTHDRRYTRLLRDLVTAGRARPGRIVTHHGSLA
DAPGCYQRFDRRQDVIKAVLHP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcagtgtcgacgtgtgcgaggtacccgaccccgaggtgcaggaggagaccgacgcg
gtcgtacggatcacctccaccgccttgtgcggcaccgatctgcacatgtacgacggccgt
accggcgcacagcccggccttgtgctcggccacgagccgctgggcgtggtcgaacgggtg
gggtcggcggtgcagaccgtgcgcccggggacccgggtggtgattcccacccacctgttc
tgcggtgtctgcgccatgtgcgcccgtggcctgtccgcgttgtgtctgcgcgcccggccc
gacggactcggcgccgcgtacggctatgtgggcatgggcccgtatccgggtgcgcaggcc
gaactgctgcgggtgccgtgggccgacgcgaactgcctgcccctgccgggcgagccgggg
gacgcgtacgaggacgacttcgtgctgctcgccgacgccttcgtcaccggttggcacgcc
gccgccaccctcgccgacgtacgcgccggggacaccgtcgccgtgttcggcgccggcacg
atcggactgctcgccgcgtacgccgccggcctgctcggcgcccgcaccgtgtacagcgtc
gaccacgtcgacgcccggctgggcaaggccgaggagttgggcgcggtgccgatggacttc
cggcagggagatccggtcgagcagatccgggccgaccgggcccggcggggcctgccgttg
ggggaggagaagctgcccggcgtggacaaggtcatcgacgcggtcggcttccaggcccac
gaccgggcccaccccgaccgggaacgcgccgaccaggtgctcgccgacgcggcccggctg
gtcaatccgggcggcgcggtcgccgtcgccggtgtctacccggaatccgacagcactccc
caagcgggcggcagcgccgacgggcacctcgacgcaccgtggggcaccttcttcgccaag
gccgtcgcgctgcggttcgggcgtacccacgatcgccgctacacccggctgctgcgggac
ctggtgaccgccggtcgggcccgacccggccggatcgtcacccaccatggcagcctggcc
gacgcccccggctgctaccagcgcttcgaccggcggcaggacgtgatcaaggcggtcctg
cacccgtga

DBGET integrated database retrieval system