KEGG   Verrucosispora maris: VAB18032_26010Help
Entry
VAB18032_26010    CDS       T01471                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vma  Verrucosispora maris
Pathway
vma00010  Glycolysis / Gluconeogenesis
vma00051  Fructose and mannose metabolism
vma00562  Inositol phosphate metabolism
vma01100  Metabolic pathways
vma01110  Biosynthesis of secondary metabolites
vma01120  Microbial metabolism in diverse environments
vma01130  Biosynthesis of antibiotics
vma01200  Carbon metabolism
vma01230  Biosynthesis of amino acids
Module
vma_M00002  Glycolysis, core module involving three-carbon compounds
vma_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAB18032_26010 (tpiA)
   00051 Fructose and mannose metabolism
    VAB18032_26010 (tpiA)
   00562 Inositol phosphate metabolism
    VAB18032_26010 (tpiA)
Enzymes [BR:vma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VAB18032_26010 (tpiA)
Exosome [BR:vma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VAB18032_26010 (tpiA)
  Exosomal proteins of bladder cancer cells
   VAB18032_26010 (tpiA)
  Exosomal proteins of melanoma cells
   VAB18032_26010 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEB46300
UniProt: F4FFJ8
Position
complement(4803182..4803973)
Genome map
AA seq 263 aa AA seqDB search
MASAPRRPLMAGNWKMNLNHLEANLLVQKLAASLTEKQLTEVETVVLPPFTDLRTVQTVV
EGDKLLIGYGAQDLSAHASGAYTGEVAGSMLAKLGCTYVVVGHSERREYHREDDALVGAK
VQAALANGLTPILCVGEGLDVREQGGQVAHCTEQLDAALKGLSAEQVTKVVVAYEPVWAI
GTGKTATPEDAQEVCGALRTRLAETFDQATADQVRVLYGGSVKSSNVASIMAQPDVDGAL
VGGASLDAEEFAKICRFPEHITG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgctccccgccggcccctgatggccggcaactggaagatgaacctcaaccac
ctcgaggccaacctgctggtgcagaagctggcggccagcctcaccgagaagcagctcacc
gaggtggagacggtggtcctgccgccgttcaccgacctgcggacggtgcagaccgtcgtg
gagggcgacaagctgctgatcggctacggggcgcaggacctctccgcgcacgcctcgggc
gcctacaccggcgaggtcgccgggtcgatgctggccaagctcggctgcacgtacgtggtg
gtcgggcactccgagcggcgggagtaccatcgcgaggacgacgcgctggtgggcgccaag
gtgcaggccgcgctggccaacgggctcaccccgatcctctgcgtgggggaggggctcgac
gtccgggagcagggcgggcaggtcgcgcactgcaccgagcagctcgacgcggcgctcaag
gggctctccgccgagcaggtgaccaaggttgtggtggcctacgagccggtctgggcgatc
ggcaccggcaagacggccaccccggaggacgcccaggaggtctgcggcgcgctgcgtacc
cggctcgccgagaccttcgaccaggccaccgcggaccaggtacgggtcctctacggtggc
tcggtgaagtcctcgaacgtcgcgtcgatcatggcccagccggacgtggacggcgccctg
gttggcggtgccagcctcgacgccgaggagttcgcgaagatctgccggttcccggagcac
atcaccggctga

DBGET integrated database retrieval system