KEGG   Verrucosispora maris: VAB18032_26010Help
Entry
VAB18032_26010    CDS       T01471                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vma  Verrucosispora maris
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VAB18032_26010 (tpiA)
   01230 Biosynthesis of amino acids
    VAB18032_26010 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VAB18032_26010 (tpiA)
   00051 Fructose and mannose metabolism
    VAB18032_26010 (tpiA)
   00562 Inositol phosphate metabolism
    VAB18032_26010 (tpiA)
Enzymes [BR:vma01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     VAB18032_26010 (tpiA)
Exosome [BR:vma04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   VAB18032_26010 (tpiA)
  Exosomal proteins of bladder cancer cells
   VAB18032_26010 (tpiA)
  Exosomal proteins of melanoma cells
   VAB18032_26010 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4803182..4803973)
Genome map
AA seq 263 aa AA seqDB search
MASAPRRPLMAGNWKMNLNHLEANLLVQKLAASLTEKQLTEVETVVLPPFTDLRTVQTVV
EGDKLLIGYGAQDLSAHASGAYTGEVAGSMLAKLGCTYVVVGHSERREYHREDDALVGAK
VQAALANGLTPILCVGEGLDVREQGGQVAHCTEQLDAALKGLSAEQVTKVVVAYEPVWAI
GTGKTATPEDAQEVCGALRTRLAETFDQATADQVRVLYGGSVKSSNVASIMAQPDVDGAL
VGGASLDAEEFAKICRFPEHITG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcgctccccgccggcccctgatggccggcaactggaagatgaacctcaaccac
ctcgaggccaacctgctggtgcagaagctggcggccagcctcaccgagaagcagctcacc
gaggtggagacggtggtcctgccgccgttcaccgacctgcggacggtgcagaccgtcgtg
gagggcgacaagctgctgatcggctacggggcgcaggacctctccgcgcacgcctcgggc
gcctacaccggcgaggtcgccgggtcgatgctggccaagctcggctgcacgtacgtggtg
gtcgggcactccgagcggcgggagtaccatcgcgaggacgacgcgctggtgggcgccaag
gtgcaggccgcgctggccaacgggctcaccccgatcctctgcgtgggggaggggctcgac
gtccgggagcagggcgggcaggtcgcgcactgcaccgagcagctcgacgcggcgctcaag
gggctctccgccgagcaggtgaccaaggttgtggtggcctacgagccggtctgggcgatc
ggcaccggcaagacggccaccccggaggacgcccaggaggtctgcggcgcgctgcgtacc
cggctcgccgagaccttcgaccaggccaccgcggaccaggtacgggtcctctacggtggc
tcggtgaagtcctcgaacgtcgcgtcgatcatggcccagccggacgtggacggcgccctg
gttggcggtgccagcctcgacgccgaggagttcgcgaagatctgccggttcccggagcac
atcaccggctga

DBGET integrated database retrieval system