KEGG   Verrucosispora maris: VAB18032_26576Help
Entry
VAB18032_26576    CDS       T01471                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vma  Verrucosispora maris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VAB18032_26576 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VAB18032_26576 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VAB18032_26576 (trpA)
Enzymes [BR:vma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VAB18032_26576 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4909209..4910027)
Genome map
AA seq 272 aa AA seqDB search
MSEQQSRIGVVFDKARAEGRAVLIGCMPAGFPTVEGSITAMKAMVAAGVDVIELEIPYSD
PVMDGPVIQRASDIALAGGVRTRDALRIIEEVTATGAPVVTMTYWNPIEQYGVDAFARDL
ASAGGTGLITPDLIPEEAGEWLAASDAHGLDRTFLVAPSSTDERLAMTVEHCRGFVYATA
LMGVTGARTQTSEAAPVLVSRVRKVTDLPVGVGLGVGTGAQAATVAGYADGVIVGSALIR
CLLDTPDEPTALTALTTLTTALATGVRHPATP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcagcagagccggatcggggtggtcttcgacaaggcgcgggcggagggccgg
gcggtgctgatcggctgcatgccggccggattcccgaccgtcgagggcagcatcacggcg
atgaaggcgatggtggcggccggggtcgacgtgatcgagctggagatcccgtactccgac
ccggtgatggacggcccggtcatccagcgggccagcgacatcgcgctggccgggggcgta
cgcacccgggacgcgttgcggatcatcgaggaggtcacggccaccggcgcgccggtggtc
acgatgacctactggaacccgatcgagcagtacggcgtggacgcgttcgcccgggatctc
gcctcggccggtggcaccggacttatcacgcccgatctgattcccgaggaagccggcgag
tggctcgccgcctcggacgcccacgggctggaccgtacgttcctggtcgcgccctcgtcg
acggacgagcggctggcgatgactgtcgaacactgccgcggtttcgtctacgccaccgcg
ctgatgggtgtgaccggtgcccggacgcagacctcggaggcggcgcccgtgctggtgtcc
cgggtccgcaaggtgaccgacctgcccgtcggcgtcggcctcggggtgggcaccggcgcc
caggcggccaccgtcgccggctacgccgacggcgtgatcgtcggcagcgccctgatccgt
tgcctcctcgacacccccgacgaacccaccgccctcacggccctgaccaccctcaccacc
gccctggccaccggcgtccgccaccccgccaccccctaa

DBGET integrated database retrieval system