KEGG   Verrucosispora maris: VAB18032_26581Help
Entry
VAB18032_26581    CDS       T01471                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vma  Verrucosispora maris
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VAB18032_26581
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VAB18032_26581
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VAB18032_26581
Enzymes [BR:vma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VAB18032_26581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4910024..4911283)
Genome map
AA seq 419 aa AA seqDB search
MSAGHGRSTAESAGPAAQFPDAAGHFGRFGGRFVPEALVAALEELDVAHRTAMADEAFRA
EFGALLRDYAGTPSLLYEARRFSARAGARVLLKREDLNHTGAHKVRNVLGQALLTRRMGK
KRVIAETGAGQHGVATATAAALFDLDCVVYMGQVDTERQALNVARMRMLGATVVPVTTGS
RTLKDAMNEAMRDWVANVDDTHYLIGTAAGPHPFPALVRDFVRGIGDEARQQCLDLTGAL
PDAVTACVGGGSNALGIFHAFVDDPQVRLYGFEAGGEGVASGRHAASITGGSAGVLHGTR
TYVLQDADGQTVESHSISAGLDYPGVGPEHAWLHDTGRASYLPITDDEAMAAFELLCRTE
GIIPAIESSHALAGTLAIAGKLAAELGRQPTIVVNLSGRGDKDVHTAGGYFGILDGESA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaggtcacggcaggagcaccgcggagtcggccggcccggcggcgcagttcccg
gacgccgccggtcacttcggtcgtttcggcgggcggttcgtgccggaggcgctggtcgcg
gccctggaggaactggacgtcgcacaccgtacggcgatggccgacgaggcgttccgcgcc
gagttcggcgcgctgctgcgcgactacgcgggcaccccgtcgctgctgtacgaggcccgc
cgcttctccgcccgcgccggtgcccgggtgctgctcaagcgcgaggacctcaaccacacc
ggcgcgcacaaggtccgcaacgtgctcggccaggcgttgctcacccggcggatgggcaag
aagcgggtgatcgccgagaccggcgccggtcagcacggcgtcgccaccgccaccgcggcc
gccctgttcgacctcgactgcgtggtgtacatgggtcaggtcgacaccgagcggcaggcg
ctgaacgtggcccggatgcggatgctcggcgccaccgtcgtcccggtcaccaccggcagc
cgtacgctcaaggacgcgatgaacgaggcgatgcgcgactgggtcgcgaacgtcgacgac
acgcactacctgatcggcaccgccgccggcccgcacccgttcccggcgctggtccgcgac
ttcgtccggggtatcggcgacgaggcccggcagcagtgcctcgacctgaccggcgcgctg
ccggacgcagtgaccgcctgtgtcggcggcggctccaacgcgctgggcatcttccacgcc
ttcgtcgacgacccgcaggtgcggctgtacggcttcgaggccggcggcgagggggtggcc
agcggccggcacgcggccagcatcaccggtggctccgcgggcgtcctgcacggcacccgc
acctacgtgctccaggacgccgacgggcagacggtcgagtcgcactcgatctccgccggc
ctggactatccgggtgtcggcccggagcacgcctggttgcacgacaccgggcgggccagc
tacctgccgatcaccgacgacgaggcgatggcggcgttcgagctgctctgccgtaccgag
ggcatcattccggcgatcgagagctcgcacgcgctcgccggcaccctggccatcgccggg
aagctcgccgccgagttgggtcggcagcccaccatcgtggtcaacctctccggccggggc
gacaaggacgtgcacaccgccggcgggtacttcggcatcctggacggggagtcggcatga

DBGET integrated database retrieval system