KEGG   Verrucosispora maris: VAB18032_26586Help
Entry
VAB18032_26586    CDS       T01471                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
vma  Verrucosispora maris
Pathway
vma00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vma01100  Metabolic pathways
vma01110  Biosynthesis of secondary metabolites
vma01130  Biosynthesis of antibiotics
vma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vma00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VAB18032_26586
Enzymes [BR:vma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VAB18032_26586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh OMPdecase PDZ IMPDH
Motif
Other DBs
NCBI-ProteinID: AEB46394
UniProt: F4FHM5
Position
complement(4911321..4912124)
Genome map
AA seq 267 aa AA seqDB search
MLDEILAGVREDVARRQEQVPLERIRELAAAAPPPLDAYAALRRPGVAVIAEVKRSSPSK
GQLAEIADPAELAGEYAAGGARAISVLTEGRWFGGSLDDLASVRAAVNIPVLRKDFVVSS
YQVHEARAHGADLVLLIVAALEQNVLVGLLERIESLGMTALVEVHDEEEADRALEAGAQV
IGVNARDLRTLEVDRSVFERIAPGLPSSVVKIAESGVRGPHDLIRYASAGADAVLVGEGL
VTKKSPREAVAELVNAGNHPATPRPVR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgacgagatcctggccggcgtccgcgaggacgtggcccggcggcaggagcaggtt
ccgctggagcggatccgcgaactcgccgccgccgccccaccgccgttggacgcgtacgcg
gccctgcggcggccgggcgtcgccgtcatcgccgaggtgaagcgctcatcgccgtccaag
ggccagttggcggagatcgccgacccggccgagctggccggcgagtacgccgccggtggg
gcccgggcgatcagtgtgctcaccgaagggcgctggttcggtggctcgctggacgacctc
gcctcggtgcgggccgcggtgaacatcccggtgctccgtaaggacttcgtggtctccagc
tatcaggtgcacgaggcccgtgcgcacggcgcggacctggtgctgctgatcgtcgccgcg
ctggagcagaacgtgctggtcggcctgctggagcggatcgagtcgctgggcatgaccgcg
ctggtcgaggtgcacgacgaggaggaggccgaccgggctctggaggccggtgcgcaggtg
atcggcgtcaacgcccgcgacctgcgtaccttggaggtcgaccggtcggtgttcgagcgg
atcgcaccggggctgccgagcagcgtcgtcaagatcgccgagtccggcgtacgcggtccg
cacgacctgatccggtacgcctccgcgggtgccgacgcggtcctggtcggtgagggcctg
gtcaccaagaagagtccccgcgaggcggtggccgaactggtcaacgccggaaaccacccg
gccacgccccgtccggtgcgctga

DBGET integrated database retrieval system